25 resultados para Inspection of schools

em Doria (National Library of Finland DSpace Services) - National Library of Finland, Finland


Relevância:

90.00% 90.00%

Publicador:

Resumo:

The purpose of this study was to investigate the effects of information and communication technology (ICT) on school from teachers’ and students’ perspectives. The focus was on three main subject matters: on ICT use and competence, on teacher and school community, and on learning environment and teaching practices. The study is closely connected to the national educational policy which has aimed strongly at supporting the implementation of ICT in pedagogical practices at all institutional levels. The phenomena were investigated using a mixed methods approach. The qualitative data from three cases studies and the quantitative data from three statistical studies were combined. In this study, mixed methods were used to investigate the complex phenomena from various stakeholders’ points of view, and to support validation by combining different perspectives in order to give a fuller and more complete picture of the phenomena. The data were used in a complementary manner. The results indicate that the technical resources for using ICT both at school and at homes are very good. In general, students are capable and motivated users of new technology; these skills and attitudes are mainly based on home resources and leisuretime use. Students have the skills to use new kinds of applications and new forms of technology, and their ICT skills are wide, although not necessarily adequate; the working habits might be ineffective and even wrong. Some students have a special kind of ICT-related adaptive expertise which develops in a beneficial interaction between school guidance and challenges, and individual interest and activity. Teachers’ skills are more heterogeneous. The large majority of teachers have sufficient skills for everyday and routine working practices, but many of them still have difficulties in finding a meaningful pedagogical use for technology. The intensive case study indicated that for the majority of teachers the intensive ICT projects offer a possibility for learning new skills and competences intertwined in the work, often also supported by external experts and a collaborative teacher community; a possibility that “ordinary” teachers usually do not have. Further, teachers’ good ICT competence help them to adopt new pedagogical practices and integrate ICT in a meaningful way. The genders differ in their use of and skills in ICT: males show better skills especially in purely technical issues also in schools and classrooms, whereas female students and younger female teachers use ICT in their ordinary practices quite naturally. With time, the technology has become less technical and its communication and creation affordances have become stronger, easier to use, more popular and motivating, all of which has increased female interest in the technology. There is a generation gap in ICT use and competence between teachers and students. This is apparent especially in the ICT-related pedagogical practices in the majority of schools. The new digital affordances not only replace some previous practices; the new functionalities change many of our existing conceptions, values, attitudes and practices. The very different conceptions that generations have about technology leads, in the worst case, to a digital gap in education; the technology used in school is boring and ineffective compared to the ICT use outside school, and it does not provide the competence needed for using advanced technology in learning. The results indicate that in schools which have special ICT projects (“ICT pilot schools”) for improving pedagogy, these have led to true changes in teaching practices. Many teachers adopted student-centred and collaborative, inquiry-oriented teaching practices as well as practices that supported students' authentic activities, independent work, knowledge building, and students' responsibility. This is, indeed, strongly dependent on the ICT-related pedagogical competence of the teacher. However, the daily practices of some teachers still reflected a rather traditional teacher-centred approach. As a matter of fact, very few teachers ever represented solely, e.g. the knowledge building approach; teachers used various approaches or mixed them, based on the situation, teaching and learning goals, and on their pedagogical and technical competence. In general, changes towards pedagogical improvements even in wellorganised developmental projects are slow. As a result, there are two kinds of ICT stories: successful “ICT pilot schools” with pedagogical innovations related to ICT and with school community level agreement about the visions and aims, and “ordinary schools”, which have no particular interest in or external support for using ICT for improvement, and in which ICT is used in a more routine way, and as a tool for individual teachers, not for the school community.

Relevância:

90.00% 90.00%

Publicador:

Resumo:

Cutting of thick section stainless steel and mild steel, and medium section aluminium using the high power ytterbium fibre laser has been experimentally investigated in this study. Theoretical models of the laser power requirement for cutting of a metal workpiece and the melt removal rate were also developed. The calculated laser power requirement was correlated to the laser power used for the cutting of 10 mm stainless steel workpiece and 15 mm mild steel workpiece using the ytterbium fibre laser and the CO2 laser. Nitrogen assist gas was used for cutting of stainless steel and oxygen was used for mild steel cutting. It was found that the incident laser power required for cutting at a given cutting speed was lower for fibre laser cutting than for CO2 laser cutting indicating a higher absorptivity of the fibre laser beam by the workpiece and higher melting efficiency for the fibre laser beam than for the CO2 laser beam. The difficulty in achieving an efficient melt removal during high speed cutting of the 15 mmmild steel workpiece with oxygen assist gas using the ytterbium fibre laser can be attributed to the high melting efficiency of the ytterbium fibre laser. The calculated melt flow velocity and melt film thickness correlated well with the location of the boundary layer separation point on the 10 mm stainless steel cut edges. An increase in the melt film thickness caused by deceleration of the melt particles in the boundary layer by the viscous shear forces results in the flow separation. The melt flow velocity increases with an increase in assist gas pressure and cut kerf width resulting in a reduction in the melt film thickness and the boundary layer separation point moves closer to the bottom cut edge. The cut edge quality was examined by visual inspection of the cut samples and measurement of the cut kerf width, boundary layer separation point, cut edge squareness (perpendicularity) deviation, and cut edge surface roughness as output quality factors. Different regions of cut edge quality in 10 mm stainless steel and 4 mm aluminium workpieces were defined for different combinations of cutting speed and laserpower.Optimization of processing parameters for a high cut edge quality in 10 mmstainless steel was demonstrated

Relevância:

90.00% 90.00%

Publicador:

Resumo:

The focus of the present work was on 10- to 12-year-old elementary school students’ conceptual learning outcomes in science in two specific inquiry-learning environments, laboratory and simulation. The main aim was to examine if it would be more beneficial to combine than contrast simulation and laboratory activities in science teaching. It was argued that the status quo where laboratories and simulations are seen as alternative or competing methods in science teaching is hardly an optimal solution to promote students’ learning and understanding in various science domains. It was hypothesized that it would make more sense and be more productive to combine laboratories and simulations. Several explanations and examples were provided to back up the hypothesis. In order to test whether learning with the combination of laboratory and simulation activities can result in better conceptual understanding in science than learning with laboratory or simulation activities alone, two experiments were conducted in the domain of electricity. In these experiments students constructed and studied electrical circuits in three different learning environments: laboratory (real circuits), simulation (virtual circuits), and simulation-laboratory combination (real and virtual circuits were used simultaneously). In order to measure and compare how these environments affected students’ conceptual understanding of circuits, a subject knowledge assessment questionnaire was administered before and after the experimentation. The results of the experiments were presented in four empirical studies. Three of the studies focused on learning outcomes between the conditions and one on learning processes. Study I analyzed learning outcomes from experiment I. The aim of the study was to investigate if it would be more beneficial to combine simulation and laboratory activities than to use them separately in teaching the concepts of simple electricity. Matched-trios were created based on the pre-test results of 66 elementary school students and divided randomly into a laboratory (real circuits), simulation (virtual circuits) and simulation-laboratory combination (real and virtual circuits simultaneously) conditions. In each condition students had 90 minutes to construct and study various circuits. The results showed that studying electrical circuits in the simulation–laboratory combination environment improved students’ conceptual understanding more than studying circuits in simulation and laboratory environments alone. Although there were no statistical differences between simulation and laboratory environments, the learning effect was more pronounced in the simulation condition where the students made clear progress during the intervention, whereas in the laboratory condition students’ conceptual understanding remained at an elementary level after the intervention. Study II analyzed learning outcomes from experiment II. The aim of the study was to investigate if and how learning outcomes in simulation and simulation-laboratory combination environments are mediated by implicit (only procedural guidance) and explicit (more structure and guidance for the discovery process) instruction in the context of simple DC circuits. Matched-quartets were created based on the pre-test results of 50 elementary school students and divided randomly into a simulation implicit (SI), simulation explicit (SE), combination implicit (CI) and combination explicit (CE) conditions. The results showed that when the students were working with the simulation alone, they were able to gain significantly greater amount of subject knowledge when they received metacognitive support (explicit instruction; SE) for the discovery process than when they received only procedural guidance (implicit instruction: SI). However, this additional scaffolding was not enough to reach the level of the students in the combination environment (CI and CE). A surprising finding in Study II was that instructional support had a different effect in the combination environment than in the simulation environment. In the combination environment explicit instruction (CE) did not seem to elicit much additional gain for students’ understanding of electric circuits compared to implicit instruction (CI). Instead, explicit instruction slowed down the inquiry process substantially in the combination environment. Study III analyzed from video data learning processes of those 50 students that participated in experiment II (cf. Study II above). The focus was on three specific learning processes: cognitive conflicts, self-explanations, and analogical encodings. The aim of the study was to find out possible explanations for the success of the combination condition in Experiments I and II. The video data provided clear evidence about the benefits of studying with the real and virtual circuits simultaneously (the combination conditions). Mostly the representations complemented each other, that is, one representation helped students to interpret and understand the outcomes they received from the other representation. However, there were also instances in which analogical encoding took place, that is, situations in which the slightly discrepant results between the representations ‘forced’ students to focus on those features that could be generalised across the two representations. No statistical differences were found in the amount of experienced cognitive conflicts and self-explanations between simulation and combination conditions, though in self-explanations there was a nascent trend in favour of the combination. There was also a clear tendency suggesting that explicit guidance increased the amount of self-explanations. Overall, the amount of cognitive conflicts and self-explanations was very low. The aim of the Study IV was twofold: the main aim was to provide an aggregated overview of the learning outcomes of experiments I and II; the secondary aim was to explore the relationship between the learning environments and students’ prior domain knowledge (low and high) in the experiments. Aggregated results of experiments I & II showed that on average, 91% of the students in the combination environment scored above the average of the laboratory environment, and 76% of them scored also above the average of the simulation environment. Seventy percent of the students in the simulation environment scored above the average of the laboratory environment. The results further showed that overall students seemed to benefit from combining simulations and laboratories regardless of their level of prior knowledge, that is, students with either low or high prior knowledge who studied circuits in the combination environment outperformed their counterparts who studied in the laboratory or simulation environment alone. The effect seemed to be slightly bigger among the students with low prior knowledge. However, more detailed inspection of the results showed that there were considerable differences between the experiments regarding how students with low and high prior knowledge benefitted from the combination: in Experiment I, especially students with low prior knowledge benefitted from the combination as compared to those students that used only the simulation, whereas in Experiment II, only students with high prior knowledge seemed to benefit from the combination relative to the simulation group. Regarding the differences between simulation and laboratory groups, the benefits of using a simulation seemed to be slightly higher among students with high prior knowledge. The results of the four empirical studies support the hypothesis concerning the benefits of using simulation along with laboratory activities to promote students’ conceptual understanding of electricity. It can be concluded that when teaching students about electricity, the students can gain better understanding when they have an opportunity to use the simulation and the real circuits in parallel than if they have only the real circuits or only a computer simulation available, even when the use of the simulation is supported with the explicit instruction. The outcomes of the empirical studies can be considered as the first unambiguous evidence on the (additional) benefits of combining laboratory and simulation activities in science education as compared to learning with laboratories and simulations alone.

Relevância:

90.00% 90.00%

Publicador:

Resumo:

The thesis consists of four studies (articles I–IV) and a comprehensive summary. The aim is to deepen understanding and knowledge of newly qualified teachers’ experiences of their induction practices. The research interest thus reflects the ambition to strengthen the research-based platform for support measures. The aim can be specified in the following four sub-areas: to scrutinise NQTs’ experiences of the profession in the transition from education to work (study I), to describe and analyse NQTs’ experiences of their first encounters with school and classroom (study II), to explore NQTs’ experiences of their relationships within the school community (study III), to view NQTs’ experiences of support through peer-group mentoring as part of the wider aim of collaboration and assessment (study IV). The overall theoretical perspective constitutes teachers’ professional development. Induction forms an essential part of this continuum and can primarily be seen as a socialisation process into the profession and the social working environment of schools, as a unique phase of teachers’ development contributing to certain experiences, and as a formal programme designed to support new teachers. These lines of research are initiated in the separate studies (I–IV) and deepened in the theoretical part of the comprehensive summary. In order to appropriately understand induction as a specific practice the lines of research are in the end united and discussed with help of practice theory. More precisely the theory of practice architectures, including semantic space, physical space-time and social space, are used. The methodological approach to integrating the four studies is above all represented by abduction and meta-synthesis. Data has been collected through a questionnaire survey, with mainly open-ended questions, and altogether ten focus group meetings with newly qualified primary school teachers in 2007–2008. The teachers (n=88 in questionnaire, n=17 in focus groups), had between one and three years of teaching experience. Qualitative content analysis and narrative analysis were used when analysing the data. What is then the collected picture of induction or the first years in the profession if scrutinising the results presented in the articles? Four dimensions seem especially to permeate the studies and emerge when they are put together. The first dimension, the relational ˗ emotional, captures the social nature of induction and teacher’s work and the emotional character intimately intertwined. The second dimension, the tensional ˗ mutable, illustrates the intense pace of induction, together with the diffuse and unclear character of a teacher’s job. The third dimension, the instructive ˗ developmental, depicts induction as a unique and intensive phase of learning, maturity and professional development. Finally, the fourth dimension, the reciprocal ˗ professional, stresses the importance of reciprocity and collaboration in induction, both formally and informally. The outlined four dimensions, or integration of results, describing induction from the experiences of new teachers, constitute part of a new synthesis, induction practice. This synthesis was generated from viewing the integrated results through the theoretical lens of practice architecture and the three spaces, semantic space, physical space-time and social space. In this way, a more comprehensive, refined and partially new architecture of teachers’ induction practices are presented and discussed.

Relevância:

90.00% 90.00%

Publicador:

Resumo:

Temat för studien handlar om gymnasielärares uppfattningar om kvalitet och om hur kvalitet kan utvecklas i gymnasieutbildningen in Tanzania. Studien är till sin karaktär kvalitativ och består av utprövade semistrukturerade intervjuer med sammanlagt trettio lärare som arbetar i fyra gymnasieskolor både i urbana och rurala miljöer. Lärarna har varierande arbetserfarenhet och undervisar i olika ämnen. Huvudfokus har gällt identifieringen av variationer i lärares uppfattningar om kvalitet. På basen av två forskningsfrågor avslöjar analysen uppfattningar av hur lärare förstår och önskar utveckla kvaliteten på gymnasieutbildningen. Resultaten visar att lärare förstår kvaliteten på utbildningen i sina skolor som försök att möta skolans och samhällets mål, som individuella prestationer och förmågor som att inneha kompetenser och som att möta utmaningar inom utbildning, Identifierade uppfattningar var baserade på lärarnas personliga kunskap, arbetsmiljön och varierande omständigheter som rådde i deras skolor. Uppfattningar om en förbättring av kvaliteten i gymnasieutbildningen innefattade utveckling av lärares motivation, skolmiljön, arbetet i klassrum, kvaliteten på lärares kunskaper och färdigheter och undervisningsmaterial. Ambitionen bakom studien ar att erbjuda en plattform för strategier för att förbättra kvaliteten på gymnasieutbildningen. Resultaten strävar till att ge en fördjupad insikt i uppfattningar hos en utvald grupp av lärare som arbetar under samma villkor inom gymnasieskolor I Tanzania. Av den här anledningen är den genererade kunskapen därför relevant för att belysa lärares uppfattningar även utanför den studerade gruppen av respondenter.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Työn tavoitteena on kartoittaa yhdyskuntalietteen käsittelyä lietteenpolttolaitoksen tarpeita ajatellen. Lietteen käsittelytekniikoiden ja kuljetusvaihtoehtojen selvittäminen on siis työn keskeinen tavoite. Lisäksi otetaan selvää näiden tekijöiden kustannusrakenteesta. Yhdyskuntalietteen ominaisuuksien sekä käsittelyyn liittyvien ongelmakohtien valottaminen kuuluu samoin työn tavoitteisiin. Työssä tehdään muun ohella case-tarkastelua Kaakkois-Suomen alueeseen liittyen. Tavoitteena on muodostaa tarkoitukseen soveltuva lietteenkäsittelymalli kullekin tapaukselle. Työn alkuosassa tutustutaan yleisesti lietteeseen sekä polttoaineen että jätteen roolissa. Tarkastelu sisältää tietoja lietteen ominaisuuksista ja muodostuvista määristä sekä lietteenkäsittelyssä olennaisista lainsäädännöllisistä seikoista. Samoin katsastetaan hieman jäteve¬denpuhdistusprosessiin sekä näin ollen lietteen syntyyn. Lietteen esikäsittelyä, mekaanista vedenerotusta, termistä kuivausta ja polttoa tarkastellaan yleisessä valossa. Mekaanisen vedenerotuksen osalta myös eritellään ja vertaillaan laitteita. Etenkin linko, mutta myös suotonauhapuristin osoittautuivat erityisen sopiviksi kunnallisen lietteen käsittelyyn. Työn loppupuoliskolla kiinnitetään huomiota lietteen varastointiin sekä syöttö-ja purkumenetelmiin, lyhyen etäisyyden siirtoon ja pidemmän matkan kuljetukseen. Case-tapauksissa pohditaan Kymenlaakson ja Etelä-Karjalan paikallisia lietteenkäsittelymahdollisuuksia. Mekaanisesti kuivattua lietettä käsitellään kyseisissätapauksissa vuosittain 6000 t ja 15 000 t. Lietteen polton tuottama sähkö- ja lämpöteho näyttävät riippuvan voimakkaasti lietteen kuiva-ainepitoisuudesta, eivät niinkään lietteen muista ominaisuuksista. Lietteenkäsittelykustannukset tiivistetystä lietteestä termiseen kuivaukseen soveltuvaksi polttoaineeksi vaihtelevat10-20 \ lietetonnia kohden, riippuen käsittelyvaiheiden määrästä. Kustannuksia syntyy eniten mekaanisesta vedenerotuksesta ja varastoinnista.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Diplomityön tavoitteena oli selvittää millainen laaduntarkastus AKD-dispersioille tulisi suorittaa kuormien vastaanotossa ja tulisiko dispersioiden laatu tarkastaa uudelleen ennen annostelua. Tätä varten seurattiin toimituserien laadun tasaisuutta ja tarkasteltiin varastointiolosuhteiden vaikutusta dispersioiden säilyvyyteen. Lisäksi kartoitettiin dispersioiden käsittelyssä ja kartonginvalmistusprosessissa esiintyvien riskitekijöiden vaikutuksia kaupallisten dispersioiden stabiilisuuteen. Kirjallisuusosassa perehdyttiin kolloidisiin dispersioihin sekä niiden stabiilisuuteen vaikuttaviin tekijöihin. AKD-dispersiot valmistetaan emulgointitekniikoiden avulla, joten dispergointimenetelmien ohella käsiteltiin myös emulsioiden valmistamista. Lisäksi luotiin katsaus dispersioteknologian tärkeimpiin analyysimenetelmiin. Alkyyliketeenidimeerin osalta käsiteltiin emulgoinnin lisäksi vahan ja muiden lisäaineiden vaikutuksia dispersioiden stabiilisuuteen ja myös niiden merkitystä dispersioiden formuloinnissa. AKD-liimauksen osalta esiin tuotiin AKD:n tärkeimmät reaktiomekanismit, sillä ne liittyvät osittain myös dispersioiden stabiilisuuteen. Lopuksi luotiin lyhyt katsaus AKD-dispersioiden stabiilisuutta käsittelevään tutkimukseen, jota on toistaiseksi julkaistu varsin niukasti. Kokeellisessaosassa tarkastelun kohteeksi valittiin neljä kaupallista alkyyliketeenidimeerinvesidispersiota, joiden koostumus ja ominaisuudet selvitettiin perusteellisesti. Tarkoituksena oli auttaa ymmärtämään dispersioiden stabiilisuudessa mahdollisesti esiintyviä eroja. Laajamittainen dispersioiden karakterisointi näyttää olevan tarpeen ainakin otettaessa uutta AKD-laatua käyttöön, sillä dispersioiden koostumus ja ominaisuudet voivat vaihdella merkittävästi. AKD-dispersioiden laadussa esiintyi vaihtelua eri toimituserien välillä. Suurimmat vaihtelut havaittiin dispersioiden varaustiloissa ja partikkelikokojakaumissa. Laadun epätasaisuuden vuoksi vastaanottotarkastuksen merkitys korostuu. Vastaanottotarkastuksessa syytä olisi kiinnittää dispersion kuiva-ainepitoisuuden ohella sen viskositeettiin, varaustilaan, tehoainepitoisuuteen sekä rakenteeseen. Rakenteen tarkastelussa optinen mikroskooppi voi rutiininomaisessa seurannassa korvata partikkelikokojakauman määrittämisen. Varastointilämpötilan vaikutus dispersioidenlaatuun on merkittävä. Dispersiot säilyvät parhaiten viileässä, joten jos varastosäiliöissä ei ole jäähdytystä, on dispersioiden laadun tarkastus tarpeen myös ennen annostelua. Jotta dispersion kunnosta saadaan luotettava arvio, on viskositeetin määrittämiseen yhdistettävä vähintään rakenteen tarkastelu optisella mikroskoopilla. Mekaaninen rasitus voi dominoivasta stabilointimekanismistariippuen aiheuttaa dispersiossa hienoaineen muodostumista tai partikkelien flokkaantumista. Stabilointimekanismi vaikuttaa niin ikään partikkelien käyttäytymiseen korkeissa lämpötiloissa. Dispersioiden stabiilisuuden todettiin heikkenevän pH:n kohotessa emäksiselle alueelle. Elektrolyyttikonsentraatio vaikuttaa partikkelien mikroelektroforeettiseen ioniliikkuvuuteen merkittävästi. Kartonkikoneen märkäosan kemikaaleista anionisen retentioaineen (BMA) todettiin vuorovaikuttavan kationisten AKD-partikkelien kanssa selvimmin. Mikroelektroforeettisen ioniliikkuvuuden mittaaminen kiertovedessä todettiin tärkeäksi, sillä se kuvaa dispersion käyttäytymistä sen käyttöympäristössä.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Julkaisu on kuvaus Agendi Modus - yrittäjyyskasvatushankkeesta, joka toteutettiin Etelä- Karjalassa vuosina 2004-2007. Samalla se on hankkeeseen osallistuneiden kokemuksista tehty vaikuttavuuden arviointiraportti. Agendi Modus-hanke oli Lappeenrannan teknillisen yliopiston Koulutus ja kehittämiskeskuksen kouluille ja yrityksille suunnattu projekti. Hankkeen tavoitteet olivat 1. pedagogisen muutoksen tuottaminen, 2. oppimisympäristöjen kehittäminen ja 3. yrittäjämäistä koulutyötä tukevan koulun kulttuurin ja johtamisen muutoksen tuottaminen. Julkaisusta käy ilmi, että hankevoi oppia yhdessä asiakkaidensa eli hankkeen yhteistyötahojen kanssa. Raportin toisessa osassa tuodaan esille muutamia yrittäjyyskasvatuksen näkökulmia. Lukija voi myös pohtia, tulisiko yrittäjyyskasvatuksen koulutuskokonaisuus rakentua kuten Agendi Moduksessa, eli esitellen aihealuetta sekäyleisesti että perehtyen sen eri olemuspuoliin. Julkaisun keskeisimmät huomiot ovat että A) hanke, joka kuuntelee asiakastaan, tuottaa sen tarvitsemia tuotteita, B) pitkäkestoinen koulutusprosessi tarjoaa mahdollisuuden ymmärtää yrittäjyyskasvatuksen metodologiaa ja pedagogiaa ja tukee aihealueen didaktiikan kokeilemista, C) on tärkeää kouluttaa sekä työyhteisöjä että näiden yksittäisiä toimijoita, D) eri osallistujilla on omanlaistaan osaamista yrittäjyyskasvatuksessa, koska kukin on valinnut erityyppistä koulutuksista itselleen soveltuvimpia, E) näyttää siltä, että noin puolet koulutuksiin osallistuneista käyttää yrittäjyyskasvatusta opetuksensa käyttöteoriana, F) oppimisympäristöjen kehittäminen on vähäisempää kuin yrittäjyyskasvatuksen käyttö oman opetuksen osana, G) hankkeen jälkeen osallistujilla on laaja ymmärrys yrittäjyyskasvatusta suosivasta oppimiskulttuurista, mutta vain harvat kokevat luovansa yrittäjämäistä koulukulttuuria. Jos uutta aihealueen hanketta suunnitellaan, se voisi keskittyä tätä hanketta tarkemmin koulukulttuurin muuttamiseen, jonka lisäksi toiminta-ajatuksissa kannattaisi huomioida oppimisen, teknologian ja yrittäjyyden strategiat.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Tämän työn tavoitteena oli helpottaa kuljetusyrityksiä toimintajärjestelmän rakentamisessa. Yrityksen toiminnan jatkuva parantaminen ja kehitystyö tehtiin huomioiden sekä talous- että ympäristötekijät. Työssä perehdyttiin laatu- ja ympäristökäsitteiden kirjallisuuteen ja niitä koskeviin lakeihin. Malli pohjautuu ISO 9001 ja ISO 14001 standardeihin. Malli toimintajärjestelmän rakentamiseksi on suunniteltu yleisohjeeksi erilaisille ja erikokoisille kuljetusyrityksille. Ei ole olemassa vain yhtä oikeaa tapaa rakentaa toimintajärjestelmä, vaan jokainen yritys rakentaa oman järjestelmän yrityksen toimintaympäristöstä ja kulttuurista riippuen. Yrityksen johdon täydellinen sitoutuminen järjestelmän rakentamiseen on ehdoton edellytys työyhteisön jäsenten sitoutumiselle uuteen toimintamalliin. Järjestelmään sisältyvät yrityksen taustatiedot ja toiminta-ajatus sekä laatu- ja ympäristöpolitiikka. Oleelliset prosessit on myös kuvattava sekä ympäristöasiat suunniteltava. Lisäksi yritysten organisaatiot on kuvattava sekä johdon katselmukset, resurssit, auditoinnit, mittaaminen, poikkeamien hallinta että jatkuva parantaminen on selvitettävä. Järjestelmän rakentamisen jälkeen suurimman haasteen muodostaa henkilöstön asenteiden ja toimintatavan muuttaminen kouluttamisen avulla. Koulutuksessa täytyy huomioida kaikki yrityksen henkilöstöryhmät. Sekä sisäisillä että ulkoisilla auditoinneilla valvotaan jatkuvaa toiminnan oikeellisuutta. Kilpailukykyyn vaikuttava järjestelmän sertifioinnin määräaikaisuus asettaa henkilöstölle motivaation jatkuvaan parantamiseen ja toiminnan kehittämiseen.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Tutkielman päätavoitteena on case -yrityksen yritysjohdon päätöksentekoa tukevan raportoinnin suunnitteleminen ja kehittäminen strategisesta näkökulmasta tarkasteltuna. Raportoinnin suunnittelun teoreettisena viitekehyksenä on käytetty balanced scorecardia. Tutkielman alatavoitteina ovat johtamisen, strategisen johtamisen, päätöksenteon, laskentatoimen, strategisen laskentatoimen ja raportoinnin tarkastelu. Tutkielmassa on käytetty konstruktiivista tutkimusmetodologiaa. Konstruktiivisessa tutkimuksessa tuotetaan teoreettisesti perusteltu ratkaisu käytännön kannalta relevanttiin ongelmaan ja tutkimuksen tuloksen voidaan todeta toimivan käytännössä. Tutkimusmenetelminä käytettiin havainnointia, haastatteluja ja keskusteluja. Todellinen tarve kehittää yrityksen raportointia antoi sysäyksensä tälle tutkielmalle. Vanhat, perinteiset yleisen laskentatoimen raportit koettiin riittämättömiksi apuvälineiksi yritysjohdolle, kun haluttiin suunnata katseita enemmän tulevaisuuden hallintaan sekä muiden osa-alueiden huomioimiseen yritysjohdon päätöksenteon tukemisessa. Lisäksi nykytrendit, kuten pitkän tähtäyksen ja strategisuuden korostuminen, kokonaisvaltaisten ja kaikki osa-alueet huomioivien tunnuslukujen yleistyminen loivat paineita raportoinnin uudistamiselle. Tutkielman tuloksena saatiin aikaan uusia raportoitavia tunnuslukuja tukemaan yritysjohdon päätöksentekoa. Tutkielman tuloksena saadut tunnusluvut sekä niistä laadittavat raportit on tarkoitus saattaa käytäntöön kohdeyrityksessä tutkielmaprosessin jälkeen.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Nykyinen strategia ajattelu perustuu filosofiaan, jossa yrityksen aineeton pääoma muuttuu aineelliseksi tulokseksi organisaatioiden resursseja, kyvykkyyksiä ja osaamista hyödyntämällä. Strategisissa tuloskorteissa oppimisen ja kasvun näkökulma kuvaa, miten ihmiset, teknologia ja organisaatioilmapiiri voivat toimia yhdessä strategian toimeenpanemiseksi. Oppimisen ja kasvun tulosten paraneminen ennakoi parannusta myös sisäisiin prosesseihin, asiakasnäkökulmaan ja taloudelliseen menestykseen. Työn teoriaosuudessa luotiin laaja katsaus eri strategiakoulukuntiin, keskittyen etenkin Mintzbergin konfiguraatio strategiakoulukunnan oppeihin. Tämän pohjalta tehtiin määritys strategia ajattelulle; strategiaprosessille ja strategialle muuttuvissa toimintaympäristöissä. Strategiaprosessin kriittiset alueet, sekä strategialähtöisen organisaation periaatteet huomioon ottaen, tehtiin kirjallisuuskartoitusta strategian toimeenpanokeinoista ja käytännön tutkimus niiden käytön yleisyydestä eri organisaatioissa. Tulosten mukaisesti monet keinot ovat aktiivisessa käytössä, mutta toisaalta on nähtävissä, että erilaiset yrityskulttuurit, organisaatioiden "elämäntilanteet" ja resurssien erilaisuudet tarjoavat erilaiset mahdollisuudet strategian toimeenpanoon ja organisaation osaamisen lisäämiseen. Nopeasti muuttuva toimintaympäristö korostaa joustavaa strategian ja sen toimeenpanon tarvetta. Osaamisen kehittäminen johtaa kasvuun; sen varmistamiseksi on löydettävä omalle organisaatioille sopivat keinot jatkuvaan oppimiseen, muutoskykyisyyden ja sitä kautta kilpailukyvyn saavuttamiseen ja ylläpitämiseen.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Multispectral images are becoming more common in the field of remote sensing, computer vision, and industrial applications. Due to the high accuracy of the multispectral information, it can be used as an important quality factor in the inspection of industrial products. Recently, the development on multispectral imaging systems and the computational analysis on the multispectral images have been the focus of a growing interest. In this thesis, three areas of multispectral image analysis are considered. First, a method for analyzing multispectral textured images was developed. The method is based on a spectral cooccurrence matrix, which contains information of the joint distribution of spectral classes in a spectral domain. Next, a procedure for estimating the illumination spectrum of the color images was developed. Proposed method can be used, for example, in color constancy, color correction, and in the content based search from color image databases. Finally, color filters for the optical pattern recognition were designed, and a prototype of a spectral vision system was constructed. The spectral vision system can be used to acquire a low dimensional component image set for the two dimensional spectral image reconstruction. The data obtained by the spectral vision system is small and therefore convenient for storing and transmitting a spectral image.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Ympäristöasioiden hallintajärjestelmät perustuvat kestävään kehitykseen. Peruslähtökohta ympäristöjärjestelmän käyttöönottoon on joko ideologiassa tai puhtaasti myynnin edistämisessä. Tässä diplomityössä lähestytään ympäristöjärjestelmää ensin yritysten näkökulmasta ja sen jälkeen koulujen ja oppilaitosten näkökulmista. Työn tavoitteina on vastata kysymykseen kuinka kehittää koulujen käyttämää Vihreä lippu ympäristöjärjestelmää entistä paremmaksi, sekä kuinka helpottaa Vihreä lippu ympäristöjärjestelmän käyttöönottoa kouluissa. Tämä tutkimus perustuu ympäristöministeriön rahoittamaan hankkeeseen "Kokemuksia Vihreä lippu ympäristöjärjestelmän käytöstä kouluissa". Hanke toteutettiin syksyn 2008 ja kevään 2009 aikana. Hankkeen tiedot kerättiin sekä kyselyiden että haastattelujen avulla. Tutkimus on luonteeltaan kvantitatiivinen, mutta siinä on myös kvalitatiivisen tutkimuksen elementtejä. Tutkimusmenetelmien yhdistäminen tässä tutkimuksessa lisää selvästi tutkimuksen validiutta. Tutkimuksen johtopaatokset näyttävät, että aivan "kivutta" ympäristöjärjestelmä ei synny kouluihin. Asiaa helpottaa suuresti, jos koulun johtoporras sitoutuu näyttävästi ympäristöjärjestelmään. Johdon sitoutuminen ympäristöjärjestelmään sitouttaa kaikki muut. Käyttöönottoa auttaa myös, jos ympäristöjärjestelmää käytetään johdon työkaluna. Lisaksi koulujen kannattaa olla avoimia kaikille sidosryhmille ja ottaa heitä reippaasti mukaan koulujen normaaliin arkeen. Myös koulujen ulkoinen ja sisäinen viestintä kannattaa ottaa suurennuslasin alle.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Painelaitteet ja kemikaaliputkistot ovat yleisiä varsinkin kemian alan yrityksissä. Omista-jan ja haltijan on tiedettävä niihin liittyvä lainsäädäntö, ja osattava soveltaa niitä käytän-töön. Työssä on selvitetty painelaitteisiin ja kemikaaliputkistoihin liittyvän lainsäädännön olen-naisin sisältö. Nykyisin painelaitteiden määräaikaistarkastuksia voidaan korvata painelait-teen seurannalla ja kunnonvalvontajärjestelmällä. Mitä se käytännössä tarkoittaa, ja onko Suomessa mahdollisuutta kuinka laajasti hyödynnetty? On tärkeää tuntea painelaitteiden ja kemikaaliputkistojen vikaantumismekanismit ja kunnonvalvontamenetelmät, jotta yritys voi luoda omaan toimintaympäristöön soveltuvan kunnonvalvontajärjestelmän tai paine-laitteiden seurannan. On pyrittävä siihen, että ongelmat havaitaan, ennen kuin vaurio syn-tyy. Kunnonvalvontajärjestelmän luomiseen ja ylläpitoon voidaan hyödyntää painelaittei-den riskiperusteiseen kunnossapitoon ja tarkastukseen tarkoitettua menettelyä. Työssä on tarkemmin käyty läpi menettelyn sisältö. Kustannustehokkuus ja tuotantolaitteiden käytettävyys ovat nousseet tärkeiksi osa-alueiksi kilpailukyvyn takaamiseksi. Painelaitteiden tarkastuksista ja muista painelaitteisiin ja ke-mikaaliputkistoihin liittyvistä ennakkohuolloista syntyvät kustannukset ovat merkittäviä. Näihin kohdistuvia kustannussäästöjä voidaan saavuttaa monin keinoin huonontamatta kuitenkaan turvallisuutta. Työssä on selvitetty kohdeyrityksen painelaitteet ja kemikaali-putkistot. Lisäksi on käyty läpi nykyinen tarkastusjaksotus, keskeisimmät viat ja tarkastuk-siin liittyvää kustannushistoriaa. Lopputuloksena on syntynyt esiselvitys ja kemikaaliputkistojen hankkimista helpottavaa tietoa. Esiselvityksen avulla kohdeyritys voi yhdessä kunnossapitoyrityksen kanssa laatia strategian painelaitteiden kunnossapidolle ja tarkastuksille. Merkittäviä kustannussäästöjä on saavutettavissa ehdotetuilla jatkotoimenpiteillä, vaikka päädyttäisiin edelleen painelait-teiden tarkastuksien osalta noudattamaan olemassa olevaa käytäntöä.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

The aim of the thesis was to study quality management with process approach and to find out how to utilize process management to improve quality. The operating environment of organizations has changed. Organizations are focusing on their core competences and networking with suppliers and customers to ensure more effective and efficient value creation for the end customer. Quality management is moving from inspection of the output to prevention of problems from occurring in the first place and management thinking is changing from functional approach to process approach. In the theoretical part of the thesis, it is studied how to define quality, how to achieve good quality, how to improve quality, and how to make sure the improvement goes on as never ending cycle. A selection of quality tools is introduced. Process approach to quality management is described and compared to functional approach, which is the traditional way to manage operations and quality. The customer focus is also studied, and it is presented, that to ensure long term customer commitment, organization needs to react to changing customer requirements and wishes by constantly improving the processes. In the experimental part the theories are tested in a process improvement business case. It is shown how to execute a process improvement project starting from defining the customer requirements, continuing to defining the process ownership, roles and responsibilities, boundaries, interfaces and the actual process activities. The control points and measures are determined for the process, as well as the feedback and corrective action process, to ensure continual improvement can be achieved and to enable verification that customer requirements are fulfilled.