917 resultados para Giant Toad


Relevância:

20.00% 20.00%

Publicador:

Resumo:

Highest growth of prawn was obtained with Feed B (743 kg/ha) with highest survival rate (60.88%) followed by Feed A where production and survival rate was 659 kg/ha and 53.50%, respectively. Feed A contained 30% dry ground cow viscera, 40% oil cake, 20% rice-bran and 10% heat bran. Feed conversion ratios were found to be 7.60:1 for Feed A and 6.46:1 for Feed B, which indicated that Feed B was more efficiently utilized by the prawn than Feed A. Statistical analysis revealed that the differences in production of prawns among the treatments were highly significant (P< 0.01).

Relevância:

20.00% 20.00%

Publicador:

Resumo:

An experiment was conducted for 105 days in 12 earthen mini ponds of each 30m² size. Five different experimental diets containing 32% protein were formulated and prepared using fishmeal, shrimp meal, soybean meal, mustard oil cake, sesame meal, wheat bran and rice bran. A commercial shrimp diet (SABINCO starter-III) was assigned to treatment six and considered as the control. Prawns were stocked at the rate of 2.5 fry/m² and feed twice daily at the rate of 10% at the beginning and reduced to 8% for the last two months. The results of the experiment showed that prawn fed diets 1, 2, and 6 (control) showed significantly (P<0.05) highest weight gain among the dietary groups, while prawn fed diet 5 showed significantly lowest weight gain. The FCR values of diets ranged between 3.06 to 4.85. Prawns fed diet 1 and 6 showed significantly higher SGR, survival (%) and production among the dietary groups. The survival (%) of the prawns ranged between 46.6 to 66.6% and the production ranged between 304.5 to 563.3 kg/ha/105 days. The result of the study showed that diet containing 30% fishmeal, 5% shrimp meal, 5% soybean meal, 10% mustard oil cake, 10% sesame meal, 20% wheat bran, 18% rice bran, 1% oyster shell and 1% vitamin premix may be recommended for monoculture of M. rosenbergii.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

A study conducted in a 450 m² earthen pond to evaluate the production potential of giant freshwater prawn (stocked at 20,000 juveniles/ha) and Indian major carps, catla and rohu (stocked at 5000 juveniles/ha in 2:1 proportion) revealed that in nine months growing period, catla and rohu attained average sizes of 357 and 746 g, respectively, while prawn weighed 48.32 g. The growth of rohu was much faster than catla as indicated by higher relative and absolute weight gains. The total fish production per hectare was estimated to be 2418 kg and prawn production stood at 780 kg with excellent survival of both the fish (>98%) and prawn (>80%).

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Effects of three different doses of vitamin D sub(3) on molting, growth, and calcium and phosphate composition of tissue and molt during the grow-out of the giant freshwater prawn Macrobrachium rosenbergii (average weight 10.56 ± 0.20 g), obtained from a grow-out pond, were studied. Intramuscular doses of vitamin D sub(3) (100, 500 and 2000 IU/kg body weight) were given on the 1st, 3rd, 5th, 7th, 9th, 11th, 13th, 15th, 20th, 25th and 30th days. All the experimental animals were fed with a basal diet containing fish meal, shrimp meal, wheat flour, groundnut de-oiled cake, soybean meal and wheat bran at 3% of the body weight. The numbers of molts were recorded as 20±0.50, 29±1.16, 51±1.87, and 30±1.60 in control, 100, 500 and 2000 IU/kg body weight physiological doses, respectively. Maximum growth was recorded in prawns given 500 IU/ kg dose. Survival was between 58.33 ± 9.13 and 77.77 ± 8.61%. The ash content and calcium level increased significantly (p<0.05) and recorded the highest values in 500 IU/kg physiological dose. However, the inorganic phosphate (P sub(i)) content recorded the highest values in tissue in 2000 IU/kg dose (p<0.05, F = 50.60613). There is no significant difference in calcium contents (p>0.05) in both tissue and molt at 500 and 2000 IU/kg doses. It was found that a higher physiological dose (2000 IU/kg) of vitamin D sub(3) increased the rate of mortality. Results have shown that vitamin D sub(3) has a positive impact on the growth and survival of M. rosenbergii and it interferes with the metabolism of Ca and P sub(i), in tissue, and alters molting frequency. Results on physiological dose suggest an alternative and effective dietary supplementation method of vitamin D sub(3) in the grow-out phase of M. rosenbergii.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Three different types of culture media: (i) 100% brine (B 100 ), (ii) 75% brine and 25% crude salt (B 75 CS 25 ), and 50% brine and 50% crude salt (B 50 CS 50) were tested to evaluate the possible use of brackish water reconstituted from the crude salt for the production of M. rosenbergii post-larvae. The production rate of 25.26±0.20 PI/l with a corresponding survival rate of 84.20±0.66% was significantly higher (P<0.05) for the larvae reared on B100 than that of 22.10±0.57 Pl/l with a corresponding survival rate of 73.68±1.89% on B50CS50. Larvae cultured on B75CS25 did not show any significant difference (P<0.05) in production as well as in survival of post-larvae than that on B100. The result shows that, for rearing of prawn larvae, use of brine can be replaced up to 25% without any undue reduction in production of post-larvae. However, the production as well as survival rate of post-larvae with 50% replacement (B50CS50) is also appreciable. It is assumed that the mineral constituents of natural seawater might have some triggering effects on prawn larvae in closing their larval cycle.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

The freshwater giant prawn (golda), Macrobrachium rosenbergii and tiger shrimp (bagda), Penaeus monodon were stocked together with or without fin fishes at different stocking rates in semi-saline waters at Khulna region and their growth, survival, yield and costreturn analysis were made. Survival rate of golda and bagda ranged from 23.0 to 36.8% and 8.2 to 24%, respectively. The both species were significantly affected by their own stocking density. The average final weight of golda and bagda ranged from 62.4 to 73.3 g and 32.0 to 66.4 g. The bivariate analysis of average final weight of both golda and bagda revealed that golda positively and bagda negatively influenced by the total stocking density. However, the results of the individual sizes of both golda and bagda showed an increase in the proportions of smaller animals and a decrease in the proportion of larger ones with increasing stocking rates. The harvesting weights of all animals in the experimental ghers were in marketable sizes although their prices varied with the individual size. The total production comprised of both golda and bagda ranged from 514.6 to 952.8 kg ha·1, over a culture period of 10 months. Return on investment ranged from 51.0 to 125.7%.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Sperata aor and S. seenghala are the two important native catfishes of Bangladesh but commercial farming of these species is not possible due to lack of naturally collected or artificially produced seeds for stocking. Attempts were made to develop techniques for seed production by artificial breeding and nursery-rearing of fries of these catfishes. A total of 60 S. seenghala (750-1,500 g) and 10 S. aor (600-1,000 g) broods were collected from the Brahmaputra river-basin and floodplains in Mymensingh region four months prior to their breeding season. The collected brood fishes were reared in separate earthen ponds with supplementary feeds comprising of rice bran (40%), mustard oil cake (29%), fish meal (30%) and vitamin-premix (1 %). Three experiments were conducted to optimize the hormone dose. A total of nine S. seenghala females weighing from 750 to 1,500 g were given an initial and resolving dose of 12-20 and 16-24 mg PG/kg body weight, respectively. The males weighing from 650-950 g were administered a single dose of 18-26 mg PG/kg body weight at the time of the time of administering the resolving dose to the females. The females ovulated partially and the eggs were examined under a compound microscope, but most of them were found to be less ripe or damaged. Collection of milt by stripping the males was not successful. The testes were taken out and sperm were observed to be non-motile and less developed. In view of stimulating natural propagation of S. seenghala, artificial holes (nests) were constructed in the pond bottom. Each hole was 0.7 m in diameter and 0.3 m in depth. A total of 10 holes were made and then 10 pairs of S. seenghala breeders (800-1,200 g) were stocked in the pond. In mid February, 3,000 fry of S. seenghala with a mean length of 4.60 cm and weight of 0.36 g were collected by repeated netting followed by drying of the pond. The fry were then stocked in a nursery pond and fed with commercial feed (SABINCO starter-1). The average length and weight of the fingerlings were 9.01 cm and 3.95 g, respectively and the estimated survival was 60% after two months of rearing. S. aor did not respond to natural spawning. Further study is essential to develop techniques for their successful artificial and natural breeding.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Amphibian skin contains rich bradykinin-related peptides, but the mode of biosynthesis of these peptides is unknown. In the present study, a novel bradykinin-related peptide, termed bombinakinin M, was purified from skin secretions of the Chinese red bell

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Amphibian skin is a rich resource of antimicrobial peptides like maximins and maximins H from toad Bombina maxima. A novel cDNA clone encoding a precursor protein that comprises maximin 3 and a novel peptide. named maximin H5. was isolated from a skin cDNA library of B. maxima. The predicted primary structure of maximin H5 is ILGPVLGLVSDTLDDVLGIL-NH2,. Containing three aspartate residues and no basic amino acid residues. maximin H5 is characterized by an anionic property. Different from cationic maximin H peptides. only Gram-positive strain Staphylococcus aureus was sensitive to maximin H5. while the other bacteria] and fungal strains tested ere resistant to it. The presence of metal ions. like Zn2+ and Mg2+, did not increase its antimicrobial potency. Maximin H5 represents the first example of potential anionic antimicrobial peptides from amphibians, The results provide the first evidence that. together kith cationic antimicrobial peptides. anionic antimicrobial peptides may also exist naturally as part of the innate defense system. (C), 2002 Elsevier Science (USA). All rights reserved.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Two groups of antimicrobial peptides have been isolated from skin secretions of Bombina maxima. Peptides in the first group, named maximins 1, 2, 3, 4 and 5, are structurally related to bombinin-like peptides (BLPs). Unlike BLPs, sequence variations in maximins occurred all through the molecules. In addition to the potent antimicrobial activity, cytotoxicity against tumor cells and spermicidal action of maximins, maximin 3 possessed a significant anti-HIV activity. Maximins 1 and 3 were toxic to mice with LD50 values of 8.2 and 4.3 mg/kg, respectively. Peptides in the second group, termed maximins H1, H2, H3 and H4, are homologous with bombinin H peptides. cDNA sequences revealed that one maximin peptide plus one maximin H peptide derived from a common larger protein. (C) 2002 Elsevier Science Inc. All rights reserved.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

A novel bombesin-related peptide was isolated from skin secretions of Chinese red belly toad Bombina maxima. Its primary structure was established as pGlu-Lys-Lys-Pro-Pro-Arg-Pro-Pro-Gln-Trp-Ala-Val-Gly-His-Phe-Met-NH2. The amino-terminal (N-terminal) 8-residue segment comprising four prolines and three basic residues is extensively different from bombesins from other Bombina species. The peptide was thus named proline rich bombesin (PR-bombesin). PR-bumbesin was found to elicit concentration-dependent contractile effects in the rat stomach strip, with both increased potency and intrinsic activity as compared with those of [Leu(13)]bombesin. Analysis of different bombesin cDNA structures revealed that an 8 to 14- nucleotide fragment replacement in the peptide coding region (TGGGGAAT in the cDNAs of multiple bombesin forms from Bombina orientalis and CACCCCGGCCACCC in the cDNA of PR-bombesin) resulted in an unusual Pro-Pro-Arg-Pro-Pro motif in the N-terminal part of PR-bombesin. (C) 2002 Elsevier Science Inc. All rights reserved.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

A novel trypsin inhibitor was identified and purified from skin secretions of Chinese red-belly toad Bombina maxima. The partial N-terminal 29 amino acid residues of the peptide, named BMTI, were determined by automated Edman degradation. This allowed the cloning of a full-length cDNA encoding BMTI from a cDNA library prepared from the toad skin. The deduced complete amino acid sequence of BMTI indicates that mature BMTI is composed of 60 amino acids. A FASTA search in the databanks revealed that BMTI exhibits 81.7% sequence identity with BSTI, a trypsin/thrombin inhibitor from European toad Bombina bombina skin secretions. Sequence differences between BMTI and BSTI were due to 11 substitutions at positions 2, 9, 25, 27, 36-37, 39, 41-42, 50 and 56. BMTI potently inhibited trypsin with a K-i value of 0.06 muM, similar to that of BSTI. However, unlike BSTI, which also inhibited thrombin with a K-i value of 1 muM, no inhibitory effect of BMTI on thrombin was observed under the assay conditions. (C) 2002 Elsevier Science Inc. All rights reserved.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Dalai-lamae (Ovis ammon dalai-lamae), Gobi (O. a. darwini), Kara Tau (O. a. nigrimontana) and Tibetan (O. a. hodgsoni) argali share a 2n = 56 diploid chromosome number and a karyotype consisting of 2 pairs of biarmed and 25 pairs of acrocentric autosomes, a large acrocentric X and a minute Y chromosome. The Giemsa-banding patterns of the largest pair of biarmed chromosomes were identical to those of the largest biarmed chromosomes in all wild sheep and domestic sheep of the genus Ovis. The banding patterns of the second pair of biarmed chromosomes (metacentric) were identical to the third pair of biarmed chromosomes in Ovis with 2n = 54 and to the third largest pair of chromosomes in the 2n = 52 karyotype of Siberian snow sheep (O. nivicola). The G-banded karyotypes of dalai-lamae, darwini, hodgsoni and nigrimontana are consistent with all subspecies of argali (O. ammon), except that the Y chromosome is acrocentric instead of metacentric as typical of the argaliform wild sheep and Ovis. The Dalai-lamae and Tibetan argali specimens exhibit the light-colored, long-haired ruffs and body coloration typical of argalis from the Tibetan Plateau. The Gobi argali, from the extreme western Gobi, is similar to the dark phase argali.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

A novel 28-amino acid peptide, termed bombinakinin-GAP, was purified and characterized from skin secretions of the toad Bombina maxima. Its primary structure was established as DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH2, in which two cysteines form a disulfide bond. A FASTA search of SWISS-PROT databank detected a 32% sequence identity between the sequences of the peptide and a segment of rat cocaine- and amphetamine-regulated transcript (CART). Intracerebroventricular (i.c.v.) administration of the peptide induced a significant decrease in food intake in rats, suggesting that it played a role in the control of feeding by brain. Analysis of its cDNA structure revealed that this peptide is coexpressed with bombinakinin M, a bradykinin-related peptide from the same toad. Bombinakinin-GAP appears to be the first example of a novel class of bioactive peptides from amphibian skin, which may be implicated in feeding behavior. (C) 2003 Elsevier Science Inc. All rights reserved.