Bombinakinin M gene associated peptide, a novel bioactive peptide from skin secretions of the toad Bombina maxima
Data(s) |
2003
|
---|---|
Resumo |
A novel 28-amino acid peptide, termed bombinakinin-GAP, was purified and characterized from skin secretions of the toad Bombina maxima. Its primary structure was established as DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH2, in which two cysteines form a disulfide bond. A FASTA search of SWISS-PROT databank detected a 32% sequence identity between the sequences of the peptide and a segment of rat cocaine- and amphetamine-regulated transcript (CART). Intracerebroventricular (i.c.v.) administration of the peptide induced a significant decrease in food intake in rats, suggesting that it played a role in the control of feeding by brain. Analysis of its cDNA structure revealed that this peptide is coexpressed with bombinakinin M, a bradykinin-related peptide from the same toad. Bombinakinin-GAP appears to be the first example of a novel class of bioactive peptides from amphibian skin, which may be implicated in feeding behavior. (C) 2003 Elsevier Science Inc. All rights reserved. |
Identificador | |
Direitos |
Bombinakinin M gene associated peptide, a novel bioactive peptide from skin secretions of the toad Bombina maxima |
Fonte |
Lai, R; Liu, H; Lee, WH; Zhang, Y.Bombinakinin M gene associated peptide, a novel bioactive peptide from skin secretions of the toad Bombina maxima,24,199-204,(SCI-E): |
Palavras-Chave | #Biochemistry & Molecular Biology; Pharmacology & Pharmacy |
Tipo |
期刊论文 |