Black bean (Phaseolus vulgaris L.) as a protective agent against DNA damage in mice

This study was designed to evaluate the toxicogenetic or protective effect of cooked and dehydrated black beans (Phaseolus vulgaris L.) in bone marrow and peripheral blood cells of exposed mice. The frequency of micronuclei detected using the bone marrow erythrocyte micronucleus test and level of DNA lesions detected by the comet assay were chosen as end-points reflecting mutagenic and genotoxic damage, respectively. Initially, Swiss male mice were fed with a 20% black bean diet in order to detect mutagenic and genotoxic activity. However, no increase in the frequency of bone marrow micronucleated polychromatic erythrocytes (MN PCEs) or DNA lesion in leukocytes was observed. In contrast, received diets containing 1, 10 or 20% of black beans, a clear, but not dose-dependent reduction in the frequency of MN PCEs were observed in animals simultaneously treated with cyclophosphamide, an indirect acting mutagen. Similar results were observed in leukocytes by the comet assay. Commercial anthocyanin was also tested in an attempt to identify the bean components responsible for this protective effect. However, instead of being protective, the flavonoid, at the highest dose administered (50 mg/kg bw), induced primary DNA lesion, as detected by the comet assay. These data indicate the importance of food components in preventing genetic damage induced by chemical mutagens, and also reinforce the role of toxicogenetic techniques in protecting human health. (C) 2003 Elsevier Ltd. All rights reserved.

Cytotoxicity and Regenerative Proliferation as the Mode of Action for Diuron-Induced Urothelial Carcinogenesis in the Rat

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Investigação diagnóstica de erros inatos do metabolismo em um hospital universitário

OBJETIVOS: Estabelecer a freqüência de erros inatos do metabolismo (EIMs) em uma amostra de pacientes com hipótese diagnóstica de EIM proveniente do Hospital das Clínicas da Faculdade de Medicina de Botucatu da Universidade Estadual Paulista (UNESP) e analisar a metodologia empregada nessa investigação. AMOSTRA E MÉTODOS: Foram triadas para EIM, por testes químicos e técnicas cromatográficas, 1.233 amostras de urina de 905 pacientes. RESULTADOS: O diagnóstico de EIM foi estabelecido em 18 (1,98%) pacientes; 12 deles apresentaram triagem (testes químicos e cromatografias) alterada para EIM. Todos os pacientes foram diagnosticados por análises enzimáticas. CONCLUSÃO: A freqüência de EIMs diagnosticados neste estudo (1,98%), quando comparada com a literatura, foi satisfatória, uma vez que este grupo de pacientes foi proveniente de um único hospital. A metodologia provou ser eficaz, indicando 12 casos de EIM entre os 18 diagnosticados. O estudo mostra a importância de laboratórios especializados na detecção deste tipo de patologia.

Cordia verbenacea and secretion of mast cells in different animal species

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Structural and functional characterization of an acidic platelet aggregation inhibitor and hypotensive phospholipase A(2) from Bothrops jararacussu snake venom

An acidic (pI similar to 4.5) phospholipase A(2) (BthA-I-PLA(2)) was isolated from Bothrops jararacussu snake venom by ion-exchange chromatography on a CM-Sepharose column followed by reverse phase chromatography on an RP-HPLC C-18 column. It is an similar to13.7 kDa single chain Asp49 PLA(2) with approximately 122 amino acid residues, 7 disulfide bridges, and the following N-terminal sequence: 'SLWQFGKMINYVMJGESGVLQYLSYGCYCGLGGQGQPTDATDRCCFVHDCC(51). Crystals of this acidic protein diffracted beyond 2.0 Angstrom resolution. These crystals are monoclinic and have unit cell dimensions of a = 33.9, b = 63.8, c = 49.1 Angstrom, and beta = 104.0degrees. Although not myotoxic, cytotoxic, or lethal, the protein was catalytically 3-4 tithes more active than BthTX-II, a basic D49 myotoxic PLA(2) from the same venom and other Bothrops venoms. Although it showed no toxic activity, it was able to induce time-independent edema, this activity being inhibited by EDTA. In addition, BthA-I-PLA(2) caused a hypotensive response in the rat and inhibited platelet aggregation, Catalytic, antiplatelet and other activities were abolished by chemical modification with 4-bromophenacyl bromide, which is known to covalently bind to His48 of the catalytic site. Antibodies raised against crude B. jararacussu venom recognized this acidic PLA(2), while anti-Asp49-BthTX-II recognized it weakly and anti-Lys49-BthTX-I showed the least cross-reaction. These data confirm that myotoxicity does not necessarily correlate with catalytic activity in native PLA(2) homologues and that either of these two activities may exist alone. BthA-I-PLA(2), in addition to representing a relevant molecular model of catalytic activity, is also a promising hypotensive agent and platelet aggregation inhibitor for further studies. (C) 2002 Elsevier B.V. All rights reserved.

Queijo Parmesão: caracterização físico-química, microbiológica e microestrutura

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Intense blue and green photoluminescence emissions at room temperature in barium zirconate powders

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Aplicação da técnica de caminhamento elétrico em área contaminada por derivados de petróleo

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Aplicação de métodos geofísicos no monitoramento de área contaminada sob atenuação natural

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Photocatalyst TiO2-Co: the effect of doping depth profile on methylene blue degradation

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Tetraflavonoid and biflavonoids from Aristolochia ridicula

Biflavones, a chalcone-flavone, and a tetraflavonoid with a new carbon skeleton were isolated from the leaves of Aristolochia ridicula. Their structures were determined by chemical derivatizations and spectrometric analyses. (c) 2008 Elsevier Ltd. All rights reserved.

Aporphine and bisaporphine alkaloids from Aristolochia lagesiana var. intermedia

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Nutrição mineral de plantas ornamentais XI: deficiências de macronutrientes e de boro em Catharanthus Roseus (L.) G. Don e Catharanthus roseus f. albus (sweet) G. Don

Plantas de duas formas botânicas de Catharanthus roseus, de flores lilases e de flores brancas foram cultivadas em soluções nutritivas deficientes em N, P, K, Ca, Mg, S e B, e em solução completa, a fim de se obter o quadro sintomatológico das deficiências, assim como os níveis analíticos de nutrientes nas folhas, caules, raízes e flores. Manifestaram-se sintomas de deficiência claros para todos os nutrientes estudados. Nas plantas de flores lilases, as concentrações de nutrientes na matéria seca de folhas de plantas normais e deficientes foram, respectivamente, para cada nutriente estudado: N(%): 3,53-1,20; P(%): 0,35-0,11; K(%): 2,45-0,76; Ca(%): 1,77-0,81; Mg(%): 0,55-0,46; S(%):0,21-0,12; B(ppm): 382-37. Nas plantas de flores brancas, estas concentrações foram: N(%): 3,78-0,92; P(%): 0,38-0,09; K(%): 2,60-0,86; Ca(%): 1,37-1,15; Mg(%): 0,56-0,44; S(%): 0,10-0,07; B(ppm):372-39.

Metodologia para avaliação de impacto ambiental de macrófitas em mesocosmos

Este trabalho teve como objetivo analisar a metodologia para avaliação do impacto ambiental causado pelo uso de herbicidas no controle de macrófitas. O desenho e a construção dos mesocosmos são descritos em detalhes, como também a forma como foram inseridos lâminas para coleta e medida da comunidade perifítica e sedimento para avaliação da comunidade bentônica. O método utilizado foi o de fluxo contínuo, e vários parâmetros de qualidade de água foram medidos, além da determinação de resíduos na coluna d'água e no sedimento. A intenção de se utilizar um método de fluxo contínuo foi buscar uma situação mais próxima da realidade, a fim de que os resultados obtidos possam espelhar com maior exatidão os possíveis riscos provenientes do uso de substâncias químicas no controle das macrófitas. Alguns ajustes devem ser feitos nessa metodologia para melhor caracterização dos efluentes e calibração do sistema.

Thermal and mechanical properties of PVDF/PANI blends

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)