11 resultados para 46698


Relevância:

20.00% 20.00%

Publicador:

Relevância:

10.00% 10.00%

Publicador:

Resumo:

The present study aims to validate the current best-practice model of implementation effectiveness in small and mid-size businesses. Data from 135 organizations largely confirm the original model across various types of innovation. In addition, we extended this work by highlighting the importance of human resources in implementation effectiveness and the consequences of innovation effectiveness on future adoption attitudes. We found that the availability of skilled employees was positively related to implementation effectiveness. Furthermore, organizations that perceived a high level of benefits from implemented innovations were likely to have a positive attitude towards future innovation adoption. The implications of our improvements to the original model of implementation effectiveness are discussed.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

Unfolding of a protein often proceeds through partial unfolded intermediate states (PUIS). PUIS have been detected in several experimental and simulation studies. However, complete analyses of transitions between different PUIS and the unfolding trajectory are sparse. To understand such dynamical processes, we study chemical unfolding of a small protein, chicken villin head piece (HP-36), in aqueous dimethyl sulfoxide (DMSO) solution. We carry out molecular dynamics simulations at various solution compositions under ambient conditions. In each concentration, the initial step of unfolding involves separation of two adjacent native contacts, between phenyl alanine residues (11-18 and 7-18). This first step induces, under appropriate conditions, subsequent separation among other hydrophobic contacts, signifying a high degree of cooperativity in the unfolding process. The observed sequence of structural changes in HP-36 on increasing DMSO concentration and the observed sequence of PUIS, are in approximate agreement with earlier simulation results (in pure water) and experimental observations on unfolding of HP-36. Peculiar to water-DMSO mixture, an intervening structural transformation (around 15% of DMSO) in the binary mixture solvent retards the progression of unfolding as composition is increased. This is reflected in a remarkable nonmonotonic composition dependence of RMSD, radius of gyration and the fraction of native contacts. At 30% mole fraction of DMSO, we find the extended randomly coiled structure of the unfolded protein. The molecular mechanism of DMSO induced unfolding process is attributed to the initial preferential solvation of the hydrophobic side chain atoms through the methyl groups of DMSO, followed by the hydrogen bonding of the oxygen atom of DMSO to the exposed backbone NH groups of HP-36.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

A novel 28-amino acid peptide, termed bombinakinin-GAP, was purified and characterized from skin secretions of the toad Bombina maxima. Its primary structure was established as DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH2, in which two cysteines form a disulfide bond. A FASTA search of SWISS-PROT databank detected a 32% sequence identity between the sequences of the peptide and a segment of rat cocaine- and amphetamine-regulated transcript (CART). Intracerebroventricular (i.c.v.) administration of the peptide induced a significant decrease in food intake in rats, suggesting that it played a role in the control of feeding by brain. Analysis of its cDNA structure revealed that this peptide is coexpressed with bombinakinin M, a bradykinin-related peptide from the same toad. Bombinakinin-GAP appears to be the first example of a novel class of bioactive peptides from amphibian skin, which may be implicated in feeding behavior. (C) 2003 Elsevier Science Inc. All rights reserved.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

Small indigenous fish species (SIS) play very important role in the diet of the people of Bangladesh. Until recently, the possibilities of culture them in consideration with the Indian major carp yet to be explored. In view of the above, an experiment on the polyculture of carps with SIS, bata (Labeo bata) was carried out to evaluate their production performance in the on-farm condition during 15 March to 15 September 2003. Three different stocking densities of bata with carp species were given. After six months of rearing, the productions obtained were 2,466±98 kg/ha, 2,395 ±88 kg/ha and 2,074±94 kg/ha from treatments-1, 2 and 3, respectively. The highest production was obtained from treatment-1, when compared with treatments-1 and 2. The contribution of bata in terms of production was 10.31% in treatment-1, while it was 13.36% and 14.38% in treatments-2 and 3, respectively.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

Resumen tomado de la propia revista

Relevância:

10.00% 10.00%

Publicador:

Resumo:

This layer is a georeferenced raster image of the historic paper map entitled: Carte du Katay : ou, Empire de Kin, pour servir a l'histoire de Jenghiz Khan ; raportée dans l'histoire generale des voyages, tirée de l'Anglois = Kaart van Kitay, of 't Ryk der Kin, dienende tot de historie van Jenghiz Khan, uit de Engelsche in dit Bestek gebragt. ; J.V. Schley direx. It was published by Pierre de Hondt in 1749. Scale [ca. 1:1,500,000]. Covers the East China Sea and Yellow Sea regions, China, North Korea, and South Korea. Map in French and Dutch. The image inside the map neatline is georeferenced to the surface of the earth and fit to the World Miller Cylindrical projected coordinate system. All map collar and inset information is also available as part of the raster image, including any inset maps, profiles, statistical tables, directories, text, illustrations, index maps, legends, or other information associated with the principal map. This map shows features such as drainage, cities and other human settlements, territorial boundaries, shoreline features, and more. Shows also the Great Wall of China and the travels of Genghis Khan. Relief shown pictorially. This layer is part of a selection of digitally scanned and georeferenced historic maps from the Harvard Map Collection. These maps typically portray both natural and manmade features. The selection represents a range of originators, ground condition dates, scales, and map purposes.