Post-larval production of Macrobrachium rosenbergii using mass-cultured live food organisms

Macrobrachium rosenbergii post-larvae were produced in 1992 and 1993 using Artemia nauplii and cultured zooplankton Brachionus plicatilis (rotifier), Apocyclops dengizicus (copepod) and Moina sp. (cladoceran) supplemented with chopped Tubifex worms. In 1992 (first trial) two experiments were carried out under water temperature range of 24.5 to 28°C and 26.0 to 28.5 °C respectively and corresponding post-larval production was 5.6% and 86.3%. The duration of experiments was 58 and 40 days. During second trial in 1993 water temperature varied between 25.0 to 27.0°C. At the end of 59 days the post-larvae were found to be 44% of the total number of larvae stocked on the first day.

Stability of flow through multistage axial compressors

This paper describes measurements of the performance of a research stage operating in isolation and as part of a multistage compressor. It is shown that the stall point and the stalled performance of the stage are properties of the system in which it operates rather than a property of the stage itself. The consequences of this for the estimation of the stall point for compressors and compression systems are discussed. The support that the measurements give to assumptions made by mathematical models which use the concept of an 'underlying axisymmetric' characteristic, are highlighted.

A Review of the parasitic copepods of fish recorded from Ceylon with description of additional forms

The beginning of our knowledge of the copepods parasitic on fish from Ceylon is due to Bassett-Smith (1898 a) who, in a paper on "Further New Parasitic Copepods found on Fish in the Indo-Tropical Region", included seven species collected at Trincomalee and Colombo. Later in the same year, in a paper on "Some New or Rare Parasitic Copepods from the Indo-Tropical Region", he (Bassett-Smith, 1898 b) included three more species from Ceylon. Soon after, more of these parasites were obtained from Ceylon during Herdmann's investigation of the Pearl Banks. From this collection, one lot consisting of eleven species was described by Thompson and Scott (1903) and a second lot consisting of seven species was described by Wilson (1906). At that stage the number of species recorded from Ceylon made up to a total of twenty-eight and there the matter rested for another quarter of a century until, quite by chance, while collecting marine animals on a reef, Mr Kirtisinghe came across a newly dead half-beak with a learned parasite projecting from its body. Since then, in a number of occasional papers (Kirtisinghe, 1932-35, 1937, 1950, 1956, 1960) he has described thirty-eight more species of parasitic copepods from Ceylon. However, his collection included many more species which were put aside for later attention. In the present paper, while dealing with those forms in his collection which he has not recorded or described earlier, he has put together all the known forms of parasitic copepods of fish from Ceylon. A list of the host fishes with their respective parasitic copepods is also provided, types of new species, at present in the author's private collection, will be deposited in the Fisheries Department, Colombo, Ceylon.

A report on frame and catch assessment surveys on Lake Nakuwa, Lake Kyoga Basin, Uganda

Lake Nakuwa is one of the large lakes among the Kyoga drainage system lakes, located 132 km north east Off Jinja town, at 01° 091N 33° 21 1 E, an elevation 1037 m, surface area of 200 km2 and an average depth of 3.3 m. The lake is shared by the districts of Kamuli, Pallisa and the newly created district of Kaliro. howerever 80% of the landing sites are in Kaliro and less than 20% are shared between the districts of Kamuli and Pallisa. The lake is free of submerged and floating macrophytes, with lots of floating papyrus (sudds). Papyrus, hippo grass and reeds dominate the shoreline vegetation. Lake Nakuwa like the main lake Kyoga was stocked with the Nile perch and the tilapiine species namely Oreochromis niloticus, Oreochromis leucostictus and Tilapia zillii in the general stocking exercise of small lakes alild dams in the early 1970's.

Cloning of novel bombesin precursor cDNAs from skin of Bombina maxima

Amphibian skin is a rich resource of bioactive peptides like proline-rich bombesin from frog Bombina maxima. A novel cDNA clone encoding a precursor protein that comprises proline-rich bombesin and a novel peptide, designated as bombestatin, was isolated from a skin cDNA library of B. maxima. The predicted primary structure of the novel peptide is WEVLLNVALIRLELLSCRSSKDQDQKESCGMHSW, in which two cysteines form a disulfide bond. A BLAST search of databases did not detect sequences with significant similarity. Bombestatin possesses dose-dependent contractile activity on rat stomach strips. The differences between cDNAs encoding PR-bombesin plus bombestatin and PR-bombesin alone are due to fragment insertions located in 3'-coding region and 3'-untranslational region, respectively. (c) 2005 Elsevier B.V. All rights reserved.

Some socio-economic aspects of the fishermen of twin pronged floodplain wetlands in West Bengal

A socio-economic investigation was carried out in two fishermen cooperative societies namely Purba Helatala Fishermen Co-operative Society (E-1), Barhal Fishermen Co-operative Society (E-2), under Maldah district, West Bengal to which the beels (flood plains) under study belong. A total of 132 member fishermen, which constituted the sample, were personally interviewed. The age group of the fishermen of the sample in E-1 varied between 20 and 66 years whereas in E-2 it was 22 and 61 years. All the members of the sample belonged to Scheduled Caste (SC) community. The primary occupation of all the respondents of both the beels was observed to be fishing (100%). Maximum number of illiterate respondents was observed to 56% in E-2 and 35% in E-1. It has been observed that as many as 38.3% of fishermen were having fishing experience which ranging from 16 to 20 years in E-1 whereas it was 6 - 10 years (36.1%) in E-2. Maximum number of fishermen lived in thatched houses (41.66%) in E-1 whereas in E-2 most of them lived in houses made of corrugated tin/tile shed (41.66%). As many as 41.55% of E-1 and 30.55% of E-2 used dug-out canoes for their fishing. Maximum number of fishermen used cast net with individualistic approach (100%) followed by Gill net (E-1:41.56% and E-2:55.55%). Most of the fishermen of the sample participated in fishing activities for 241 to 270 days (41.66%) in E-2 whereas it was 211 to 240 days (33.33 %) in E-1 in a year. During fishing season as many as 40.0% of the respondents of E-1 earned on an average Rs. 801.00 to Rs. 900.00 per month whereas it was Rs. 901.00 to Rs.1,000.00 (43.05%) in case of E-2. A section of fishermen of the sample borrowed money often (51.6%) E-1 whereas it was most often (27.27%) of E-2. The respondents of E-2 made regular repayment of the loan to the maximum extent (79.48%) whereas it was 57.44% in E-1. Higher fish production vis-a-vis higher income for the fishermen was observed in the beel (E2) having close characteristic.

Enriched environment treatment counteracts enhanced addictive and depressive-like behavior induced by prenatal chronic stress

Prenatal stress can cause many long-term behavior changes in offspring, but whether prenatal stress can alter addictive behavior in offspring and postnatal enriched environment treatment (EE) can restore these changes are unknown. We reported here that pr

Microalgal community structure in experimental carp-pangasiid catfish polyculture ponds

Microalgal community structure in experimental carp-pangasiid catfish polyculture ponds under four different stocking rates (treatments) each with three replications in the Field Laboratory of the Faculty Fisheries, Bangladesh Agricultural University, Mymensingh was studied. A total of 38 microalgal genera were identified under four major groups: 18 genera belong to Chlorophyceae, 9 to Cyanophyceae, 8 to Bacillariophyceae and 3 to Euglenophyceae. Chlorophyceae was abundant in all treatments followed by Cyanophyceae, Bacillariophyceae and Euglenophyceae throughout the study period. The cell densities of total microalgal population varied between 51.66x10^3 cells/L in June in T1 and 126.4x10^3 cells/L in August in T2. The appearance of Microcysris, Oscillatoria, Gomphospheria, Hildenbrandia, Chlorella, Scenedesmus, Cyclotella, Navicula, Nitzschia, Euglena and Phacus as dominant genera throughout the study period may related to sufficient nutrient availability, good light conditions and high growth rate of these genera. Water quality parameters of the experimental ponds were within suitable range for microalgal production and fish culture though the nutrient (nitrate-nitrogen and phosphate-phosphorus) concentrations were high. The factors involved in structuring a phytoplankton community arise from the relationship generated by physical, chemical and biological conditions especially the stocked planktivorous carps. Microalgal bloom formation is very common in pangasiid catfish monoculture ponds but in the present study bloom was not formed and the algal species diversity was found to be slightly increased with the study period. The introduction carps of carps in the experimental ponds might have helped in controlling the microalgal bloom formation and maintenance of the species diversity.

Actions of two serine proteases from Trimeresurus jerdonii venom on chromogenic substrates and fibrinogen

Jerdonobin and jerdofibrase are two serine proteases purified from the venom of Trimeresurus jerdonii. The Michaelis constant K-m and the catalytic rate constant K-cat of jerdonobin or jerdofibrase on three chromogenic substrates, H-D-Pro-Phe-Arg-pNA (S2302), H-D-Phe-pipecolyl-Arg-pNA (S2238), and H-D-Val-Leu-Lys-pNA (S2251) were obtained from lineweaver-Burk plots. Jerdofibrase could hydrolyze all three substrates, but jerdonobin had no detectable activity on S2251, suggesting a relatively broader substrate specificity for jerdofibrase than jerdonobin. By SDS-PAGE, jerdofibrase preferentially degraded Bbeta-chain of fibrinogen. It also degraded Aalpha-chain of fibrinogen with relatively slow activity, but did not act on the gamma-chain. In contrast, jerdonobin did not degrade fibrinogen within 12 h. Fibrinopeptides liberation test, identified by HPLC, showed jerdonobin released fibrinopeptide A and a small amount of fibrinopeptide B. Unlike jerdonobin, jerdofibrase mainly released fibrinopeptide B. These results indicate that the two enzymes differ in their ability to hydrolyze chromogenic substrates and in their actions on fibrinogen. (C) 2002 Elsevier Science Inc. All rights reserved.

A novel short neurotoxin, cobrotoxin c, from monocellate cobra (Naja kaouthia) venom: isolation and purification, primary and secondary structure determination, and tertiary structure modeling

A novel short neurotoxin, cobrotoxin c (CBT C) was isolated from the venom of monocellate cobra (Naja kaouthia) using a combination of ion-exchange chromatography and FPLC. Its primary structure was determined by Edman degradation. CBT C is composed of 61 amino acid residues. It differs from cobrotoxin b (CBT B) by only two amino acid substitutions, Thr/Ala11 and Arg/Thr56, which are not located on the functionally important regions by sequence similarity. However, the LD50 is 0.08 mg/g to mice, i.e. approximately five-fold higher than for CBT B. Strikingly, a structure-function relationship analysis suggests the existence of a functionally important domain on the outside of Loop III of CBT C. The functionally important basic residues on the outside of Loop III might have a pairwise interaction with alpha subunit, instead of gamma or delta subunits of the nicotinic acetylcholine receptor (nAChR). (C) 2002 Elsevier Science Inc. All rights reserved.

Study on regional differences in soil-water characteristics and their relevance to aquaculture productivity and fish disease

A total of 45 ponds used for fish polyculture were investigated in three zones of Bangladesh to identify the differences among the zones in respect to aqua-ecology, culture practices, fish productivity and health management. Four hundred and fifty fish from three zones were clinically examined by naked eye and histopathology. Out of total number of fish examined, 45 fish from Dhaka zones were examined for parasites and bacteria in addition to histopathology. Faded and haemorrhagic gill, skin, fin, scale loss and lesions were observed during fish examination. Aeromonas spp. Pseudomonas spp. and Streptococcus spp. were isolated respectively from 56%, 46% and 39% affected fish. Among the five water quality parameters analyzed, the highest average hardness and alkalinity respectively were recorded in Rajshahi (156 ppm and 142 ppm) followed by Dhaka (146 ppm and 132 ppm) and Chittagong (81 ppm and 90 ppm). The highest average pH was recorded in Mymensingh (7.52) followed by Rajshahi (7.13) and Chittagong (7.05). Water holding capacity of soil in Rajshahi zone was poor compared to other zones and farmers were found to be reluctant to fish farming.