Receptor-specific in vivo desensitization by the G protein-coupled receptor kinase-5 in transgenic mice.

Transgenic mice were generated with cardiac-specific overexpression of the G protein-coupled receptor kinase-5 (GRK5), a serine/threonine kinase most abundantly expressed in the heart compared with other tissues. Animals overexpressing GRK5 showed marked beta-adrenergic receptor desensitization in both the anesthetized and conscious state compared with nontransgenic control mice, while the contractile response to angiotensin II receptor stimulation was unchanged. In contrast, the angiotensin II-induced rise in contractility was significantly attenuated in transgenic mice overexpressing the beta-adrenergic receptor kinase-1, another member of the GRK family. These data suggest that myocardial overexpression of GRK5 results in selective uncoupling of G protein-coupled receptors and demonstrate that receptor specificity of the GRKs may be important in determining the physiological phenotype.

Purification and characterization of a luminal cholecystokinin-releasing factor from rat intestinal secretion.

Cholecystokinin (CCK) secretion in rats and humans is inhibited by pancreatic proteases and bile acids in the intestine. It has been hypothesized that the inhibition of CCK release caused by pancreatic proteases is due to proteolytic inactivation of a CCK-releasing peptide present in intestinal secretion. To purify the putative luminal CCK-releasing factor (LCRF), intestinal secretions were collected by perfusing a modified Thiry-Vella fistula of jejunum in conscious rats. From these secretions, the peptide was concentrated by ultrafiltration followed by low-pressure reverse-phase chromatography and purified by reverse-phase high-pressure liquid chromatography. Purity was confirmed by high-performance capillary electrophoresis. Fractions were assayed for CCK-releasing activity by their ability to stimulate pancreatic protein secretion when infused into the proximal small intestine of conscious rats. Partially purified fractions strongly stimulated both pancreatic secretion and CCK release while CCK receptor blockade abolished the pancreatic response. Amino acid analysis and mass spectral analysis showed that the purified peptide is composed of 70-75 amino acid residues and has a mass of 8136 Da. Microsequence analysis of LCRF yielded an amino acid sequence for 41 residues as follows: STFWAYQPDGDNDPTDYQKYEHTSSPSQLLAPGDYPCVIEV. When infused intraduodenally, the purified peptide stimulated pancreatic protein and fluid secretion in a dose-related manner in conscious rats and significantly elevated plasma CCK levels. Immunoaffinity chromatography using antisera raised to synthetic LCRF-(1-6) abolished the CCK releasing activity of intestinal secretions. These studies demonstrate, to our knowledge, the first chemical characterization of a luminally secreted enteric peptide functioning as an intraluminal regulator of intestinal hormone release.

Arrest of endotoxin-induced hypotension by transforming growth factor beta1.

Septic shock is a cytokine-mediated process typically caused by a severe underlying infection. Toxins generated by the infecting organism trigger a cascade of events leading to hypotension, to multiple organ system failure, and frequently to death. Beyond supportive care, no effective therapy is available for the treatment of septic shock. Nitric oxide (NO) is a potent vasodilator generated late in the sepsis pathway leading to hypotension; therefore, NO represents a potential target for therapy. We have previously demonstrated that transforming growth factor (TGF) beta1 inhibits inducible NO synthase (iNOS) mRNA and NO production in vascular smooth muscle cells after its induction by cytokines critical in the sepsis cascade. Thus, we hypothesized that TGF-beta1 may inhibit iNOS gene expression in vivo and be beneficial in the treatment of septic shock. In a conscious rat model of septic shock produced by Salmonella typhosa lipopolysaccharide (LPS), TGF-beta1 markedly reduced iNOS mRNA and protein levels in several organs. In contrast, TGF-beta1 did not decrease endothelium-derived constitutive NOS mRNA in organs of rats receiving LPS. We also performed studies in anesthetized rats to evaluate the effect of TGF-beta1 on the hemodynamic compromise of septic shock; after an initial 25% decrease in mean arterial pressure, TGF-beta1 arrested LPS-induced hypotension and decreased mortality. A decrease in iNOS mRNA and protein levels in vascular smooth muscle cells was demonstrated by in situ hybridization and NADPH diaphorase staining in rats treated with TGF-beta1. Thus these studies suggest that TGF-beta1 inhibits iNOS in vivo and that TGF-beta1 may be of future benefit in the therapy of septic shock.

Learning about categories in the absence of memory.

A fundamental question about memory and cognition concerns how information is acquired about categories and concepts as the result of encounters with specific instances. We describe a profoundly amnesic patient (E.P.) who cannot learn and remember specific instances--i.e., he has no detectable declarative memory. Yet after inspecting a series of 40 training stimuli, he was normal at classifying novel stimuli according to whether they did or did not belong to the same category as the training stimuli. In contrast, he was unable to recognize a single stimulus after it was presented 40 times in succession. These findings demonstrate that the ability to classify novel items, after experience with other items in the same category, is a separate and parallel memory function of the brain, independent of the limbic and diencephalic structures essential for remembering individual stimulus items (declarative memory). Category-level knowledge can be acquired implicitly by cumulating information from multiple training examples in the absence of detectable conscious memory for the examples themselves.

Proactive and reactive inhibition during overt and covert actions. An electrical neuroimaging study.

Response inhibition is the ability to suppress inadequate but automatically activated, prepotent or ongoing response tendencies. In the framework of motor inhibition, two distinct operating strategies have been described: “proactive” and “reactive” control modes. In the proactive modality, inhibition is recruited in advance by predictive signals, and actively maintained before its enactment. Conversely, in the reactive control mode, inhibition is phasically enacted after the detection of the inhibitory signal. To date, ample evidence points to a core cerebral network for reactive inhibition comprising the right inferior frontal gyrus (rIFG), the presupplementary motor area (pre-SMA) and the basal ganglia (BG). Moreover, fMRI studies showed that cerebral activations during proactive and reactive inhibition largely overlap. These findings suggest that at least part of the neural network for reactive inhibition is recruited in advance, priming cortical regions in preparation for the upcoming inhibition. So far, proactive and reactive inhibitory mechanisms have been investigated during tasks in which the requested response to be stopped or withheld was an “overt” action execution (AE) (i.e., a movement effectively performed). Nevertheless, inhibitory mechanisms are also relevant for motor control during “covert actions” (i.e., potential motor acts not overtly performed), such as motor imagery (MI). MI is the conscious, voluntary mental rehearsal of action representations without any overt movement. Previous studies revealed a substantial overlap of activated motor-related brain networks in premotor, parietal and subcortical regions during overtly executed and imagined movements. Notwithstanding this evidence for a shared set of cerebral regions involved in encoding actions, whether or not those actions are effectively executed, the neural bases of motor inhibition during MI, preventing covert action from being overtly performed, in spite of the activation of the motor system, remain to be fully clarified. Taking into account this background, we performed a high density EEG study evaluating cerebral mechanisms and their related sources elicited during two types of cued Go/NoGo task, requiring the execution or withholding of an overt (Go) or a covert (MI) action, respectively. The EEG analyses were performed in two steps, with different aims: 1) Analysis of the “response phase” of the cued overt and covert Go/NoGo tasks, for the evaluation of reactive inhibitory control of overt and covert actions. 2) Analysis of the “preparatory phase” of the cued overt and covert Go/NoGo EEG datasets, focusing on cerebral activities time-locked to the preparatory signals, for the evaluation of proactive inhibitory mechanisms and their related neural sources. For these purposes, a spatiotemporal analysis of the scalp electric fields was applied on the EEG data recorded during the overt and covert Go/NoGo tasks. The spatiotemporal approach provide an objective definition of time windows for source analysis, relying on the statistical proof that the electric fields are different and thus generated by different neural sources. The analysis of the “response phase” revealed that key nodes of the inhibitory circuit, underpinning inhibition of the overt movement during the NoGo response, were also activated during the MI enactment. In both cases, inhibition relied on the activation of pre-SMA and rIFG, but with different temporal patterns of activation in accord with the intended “covert” or “overt” modality of motor performance. During the NoGo condition, the pre-SMA and rIFG were sequentially activated, pointing to an early decisional role of pre-SMA and to a later role of rIFG in the enactment of inhibitory control of the overt action. Conversely, a concomitant activation of pre-SMA and rIFG emerged during the imagined motor response. This latter finding suggested that an inhibitory mechanism (likely underpinned by the rIFG), could be prewired into a prepared “covert modality” of motor response, as an intrinsic component of the MI enactment. This mechanism would allow the rehearsal of the imagined motor representations, without any overt movement. The analyses of the “preparatory phase”, confirmed in both overt and covert Go/NoGo tasks the priming of cerebral regions pertaining to putative inhibitory network, reactively triggered in the following response phase. Nonetheless, differences in the preparatory strategies between the two tasks emerged, depending on the intended “overt” or “covert” modality of the possible incoming motor response. During the preparation of the overt Go/NoGo task, the cue primed the possible overt response programs in motor and premotor cortex. At the same time, through preactivation of a pre-SMA-related decisional mechanism, it triggered a parallel preparation for the successful response selection and/or inhibition during the subsequent response phase. Conversely, the preparatory strategy for the covert Go/NoGo task was centred on the goal-oriented priming of an inhibitory mechanism related to the rIFG that, being tuned to the instructed covert modality of the motor performance and instantiated during the subsequent MI enactment, allowed the imagined response to remain a potential motor act. Taken together, the results of the present study demonstrate a substantial overlap of cerebral networks activated during proactive recruitment and subsequent reactive enactment of motor inhibition in both overt and covert actions. At the same time, our data show that preparatory cues predisposed ab initio a different organization of the cerebral areas (in particular of the pre-SMA and rIFG) involved with sensorimotor transformations and motor inhibitory control for executed and imagined actions. During the preparatory phases of our cued overt and covert Go/NoGo tasks, the different adopted strategies were tuned to the “how” of the motor performance, reflecting the intended overt and covert modality of the possible incoming action.

Família à mesa: com a palavra, mães e filhos

Introdução O comportamento alimentar do indivíduo resulta de decisões, conscientes ou não, relacionadas à cultura alimentar de sua região, à tradição alimentar de seu convívio social e às transformações decorridas do acesso à informação científica e popular. Objetivo Analisar a alimentação de adolescentes, residentes na região Norte do município de São José dos Campos (SP), na perspectiva da família. Materiais e métodos Estudo qualitativo, realizado em 2014 e 2015, com mães e adolescentes do 6o ano do ensino fundamental municipal. Dados sobre percepção, conhecimento, comportamento e barreiras para uma alimentação saudável dos adolescentes foram produzidos por meio de grupos focais. Entrevistas semiestruturadas foram realizadas com as mães dos estudantes para investigar aspectos sobre alimentação da família e relação com formação de práticas e comportamentos alimentares dos filhos. Os discursos foram registrados com auxílio de um gravador de voz, e transcritos posteriormente para análise, por meio da técnica de análise de conteúdo temática. Foram realizados 4 grupos focais com 6 estudantes cada, e 15 entrevistas com mães. Resultados e discussão Os discursos foram classificados em temas: comportamento alimentar, preferências alimentares e conhecimentos e crenças. Verificou-se que a alimentação dos adolescentes pode ser influenciada pelo comportamento alimentar dos pais. Mães e adolescentes percebemse conscientes e julgam sobre o que comem. Entretanto, a fala muitas vezes está distante da prática, seja por negligencia, dificuldade em perceber possibilidades de ação, questões emotivas ou pelo hábito formado, considerado a maior dificuldade para mudanças relacionadas à alimentação, tanto das mães quanto adolescentes. Possibilidades de soluções, quando referidas, eram por vezes permeadas por conflitos, causando insatisfação em mães e filhos. O contexto no qual esses individuos estão inseridos deve ser considerado, como o bairro e a escola, os quais contribuem para a determinação das escolhas alimentares. Conclusão a família exerce importante papel no comportamento alimentar de adolescentes, entretanto, a compreensão sobre o tema deve considerar, sobretudo, a cultura e o meio social em que a dinâmica familiar está contextualizada.

Parent Loss in Adolescence and its Impact on Sense of Self: When an Adolescent Boy Loses His Mother.

Adolescence is a developmental phase that involves physical, emotional, and cognitive changes. Often this period is one of transition that requires significant adjustment both with the individual and the family. It is considered to start with puberty, sometime between the ages of 10 and 13, and end with the transition into adulthood (Kruse & Walper, 2008). Puberty is a term that is used to describe the physical changes that generally occur during adolescence. It is an aspect of the changes that occur during the overarching phase of development. Within adolescence, individuals are confronted with many developmental tasks such as establishing an individual identity, making decisions about the future, and moving from dependence on families to independence (Austrian, 2008).There are many changes that occur during adolescence, including sexual maturation and functioning, endocrine developments, and skeletal and muscular changes. Boys will see a growth of body, pubic, and facial hair, their voice will deepen, and they will begin having erections and wet dreams (Kruse & Walper, 2008). The accelerated transformation of this phase generally has an emotional impact and individuals may feel concerned or self-conscious about their appearance. Ausubel, Montemayor, and Svajian (1977) suggest that adolescents may be more sensitive during this period of development. This sensitivity may be in part due to the rapid growth resulting in a sense of awkwardness in appearance and physical coordination.

Del síndrome al sinthome

Currently, the concept of symptom is based on the notion of singularity (from a base perspective, underlined by Freud, regarding the persistence of symptomatic residue). This indicates that the demise of the symptom will never be complete, since the demand drive will always persist and will not cease to search for satisfaction.Let us then, insist on this matter, on the existence of an incurable residue in the symptom (which entails a particular relationship between the subject and its own pleasure), resisting sense and interpretation. The following paper has been elaborated following a diachronic trajectory of psychoanalytic theory, which allows establishing pauses, outlining the most important shifts produced in Freudian and Lacanian elaborations, respectively. Starting from Freud‘s productions, as main fulcrum, the Lacanian approach of the symptom will be introduced to link to the proposal of the sinthome proposed by Lacan. Freud will explain symptoms through the theory of trauma; those will find themselves hinged on mnemic traces, which will make the analysis of the patient‘s produced associations a crucial activity, to comprehend the etiology of the symptoms and the development of the cure. The clinical practice of this period may be summarized as ―the unconscious is susceptible to become conscious‖, aiming to the discovery and/or decoding of the symptoms, as long as they carry meaning. All of this at the same time, will be the base of future elaborations...

Industry Professionals Who Attain Leadership in Energy and Environmental Design (LEED) Accreditation: An Examination of Motivations in Human Resource (HR) Training and Development

Despite the economy, the green building industry continues to grow and drive the demand for environmentally conscious, highly skilled professionals (USGBC 2009). LEED Accredited Professionals (APs) have the knowledge and skills to meet such demand; however, information is limited regarding LEED APs or their motivations and expectations toward prospective employers. The author surveyed a sample of LEED Accredited architects and found a combination of job and personal factors motivated them to attain accreditation. LEED APs value both a competitive salary and commitment to sustainability in prospective employers. To attract, retain, and utilize LEED APs, executives in this industry must reexamine corporate culture, their willingness to pay for credentialing, and the alignment of their reputation with the desires of potential applicants.

Discursos interculturales y prácticas asimilacionistas: algunas contradicciones en el sistema educativo español

En este artículo se analiza el grado de coherencia entre el discurso legal, teórico y formal acerca de la gestión de la diversidad y la realidad de las prácticas pedagógicas en las instituciones educativas formales. Con este fin se aborda una revisión teórica de las distintas leyes educativas, de los discursos del profesorado y de las prácticas pedagógicas a partir de investigaciones precedentes. El principal resultado apunta a la existencia de algunas contradicciones: el concepto de asimilación cultural al mismo tiempo que se desprecia, tanto en la legislación educativa como en el discurso explícito y consciente del profesorado, acaba siendo el adoptado en la mayoría de las prácticas educativas. Este hallazgo conduce a algunas conclusiones respecto a la necesidad de repensar y redefinir el concepto de asimilación cultural desde la perspectiva de la igualdad y de una concepción crítica de la etnicidad y de la identidad.

Projeto – sustentabilidade e matemática

A disciplina matemática e o tema sustentabilidade podem ser muito bem trabalhados pelos docentes da área de exatas. Pois, saber quantificar, calcular e associar o consumo e o impacto ambiental através de dados numéricos é uma possibilidade que pode ser desenvolvida em sala de aula. Saber interpretar e construir gráficos de colunas são outras competências e habilidades presentes na ciência da matemática. Compreender conceitos, estratégias e situações matemáticas numéricas para aplicá-los a situações diversas no contexto das ciências, da tecnologia e da atividade cotidiana se faz necessário. E também, reconhecer, pela leitura de textos apropriados, a importância da Matemática na elaboração de proposta de intervenção solidária na realidade. Dessa forma, conhecer o ambiente em que vivemos, verificar a influência do homem na Natureza e quais ações deverão ser tomadas pensando nas futuras gerações é um despertar para o consumo consciente. O que acarreta como possibilidade o retorno à natureza de recursos utilizados de maneira correta. Conhecer uma conta de luz detalhada, aprender a calcular o consumo mensal de Kwh e diminuir o consumo de energia elétrica através da mudança de hábitos são exemplos cotidianos em que a matemática se faz presente. Relacionar a matemática ao estudo do meio ambiente proporciona através dos números mensurar os prejuízos e projetar soluções, torna a aprendizagem construtiva, podendo se constituir num comportamento cotidiano ou numa ação educativa para formar uma consciência ecológica dentro de indicadores reais. A aprendizagem se torna significativa quando relacionada ao cotidiano do aluno no sentido de mostrar o meio ambiente a que estão inseridos para que possam ser agentes transformadores, através da mudança de hábitos e principalmente desenvolvendo suas habilidades matemáticas. Sendo assim, o processo de ensino aprendizagem matemática-meio ambiente é realizado no sentido de oportunizar o conhecimento do mundo e domínio da natureza, com base nas linguagens matemáticas, criando-se condições de melhorar a capacidade de agir na sociedade, assumindo ações permanentes concentradas em um desenvolvimento sustentável para a continuidade da vida na Terra. Nesse diapasão, é possível desenvolver trabalhos pedagógicos “na trilha da matemática: do raciocínio ao meio-ambiente”. A resolução de situações problemas e assuntos referentes ao meio ambiente fazem com que os alunos tomem os cuidados necessários para com o meio ambiente, aos recursos por ele oferecidos e as consequências das ações errôneas causadas pelo homem.

Mens Sibi Conscia recti, 1760 February 22

Two-page handwritten composition in English signed "Jer'h Belknap Febry 22, 1760." The theme begins, "There is nothing in the world that can give a Man more secret pleasure and satisfaction than to be Conscious to himself of doing right. This is what is called Contentm't" and ends with two lines from Horace in Latin: "Hic murus aheneus esto," and "Nil Conscire sibi." A Latin version of the composition is available in Box 1, Folder 3.

SOCIAL, EMOTIONAL, COGNITIVE, AND PHYSIOLOGICAL CORRELATES OF ELECTRONIC SOCIAL BEHAVIOR

There has been very little research that has studied the capacities that can be fostered to mitigate the risk for involvement in electronic bullying or victimization and almost no research examining positive electronic behavior. The primary goal of this dissertation was to use the General Aggression Model and Anxious Apprehension Model of Trauma to explore the underlying cognitive, emotional, and self-regulation processes that are related to electronic bullying, victimization, and prosocial behavior. In Study 1, we explored several potential interpretations of the General Aggression Model that would accurately describe the relationship that electronic self-conscious appraisal, cognitive reappraisal, and activational control may have with electronic bullying and victimization. In Study 2, we used the Anxious Apprehension Model of Trauma to explore rejection cognitions as the mediator of the relationships among emotionality (emotionality, shame, state emotion responses, and physiological arousal) and electronic bullying and victimization using structural equation modelling. In addition, we explored the role of rejection cognitions in mediating the relationship of moral disengagement with electronic bullying. In Study 3, we examined predictors of electronic prosocial behavior, such as bullying, victimization, time online, electronic proficiency, electronic self-conscious appraisals, emotionality, and self-regulation. All three studies supported the General Aggression Model as a framework to guide the study of electronic behavior, and suggest the importance of cognitive, emotional, and behavioral means of regulation in shaping electronic behavior. In addition, each study has implications for the development of high quality electronic bullying prevention and intervention research.

Segurança na internet para encarregados de educação : desenvolvimento de um MOOC

Trabalho de projeto de mestrado, Educação e Formação (Área de especialização em E-Learning e Formação a Distância), Universidade de Lisboa, Instituto de Educação, 2016

A relação inconsciente-consciente na produção do pensamento consciente

Tese de mestrado, Psicologia (Ciência Cognitiva), Universidade de Lisboa, Faculdade de Psicologia, Faculdade de Letras, Faculdade de Ciências, Faculdade de Medicina, 2016