Diet of the minimal armhook squid (Berryteuthis anonychus) (Cephalopoda: Gonatidae) in the northeast Pacific during spring

The stomach contents of the minimal armhook squid (Berryteuthis anonychus) were examined for 338 specimens captured in the northeast Pacific during May 1999. The specimens were collected at seven stations between 145−165°W and 39−49°N and ranged in mantle length from 10.3 to 102.2 mm. Their diet comprised seven major prey groups (copepods, chaetognaths, amphipods, euphausiids, ostracods, unidentified fish, and unidentified gelatinous prey) and was dominated by copepods and chaetognaths. Copepod prey comprised four genera, and 86% by number of the copepods were from the genus Neocalanus. Neocalanus cristatus was the most abundant prey taxa, composing 50% by mass and 35% by number of the total diet. Parasagitta elegans (Chaetognatha) occurred in more stomachs (47%) than any other prey taxon. Amphipods occurred in 19% of the stomachs but composed only 5% by number and 3% by mass of the total prey consumed. The four remaining prey groups (euphausiids, ostracods, unidentified fish, and unidentified gelatinous prey) together composed <2% by mass and <1% by number of the diet. There was no major change in the diet through the size range of squid examined and no evidence of cannibalism or predation on other cephalopod species.

Diet composition of large striped bass (Morone saxatilis) in Chesapeake Bay

Large (>458 mm) striped bass (Morone saxatilis) are dominant predators in Chesapeake Bay. In recent years, the Chesapeake Bay stock of striped bass has increased dramatically, raising concerns about their predatory impact and their forage requirements. In response to these concerns and the need for more recent ecological studies, this investigation was conducted to characterize feeding habits of large striped bass in Chesapeake Bay. Stomach contents from 1225 striped bass from 458 to 1151 mm TL were examined in the spring and fall of 1997 and 1998. Striped bass consumed 52 different species of vertebrates and invertebrates; however, only a few species of clupeoid and sciaenid fishes dominated diets across both the seasons and size ranges of striped bass examined. Of finfish species, menhaden (Brevoortia tyrannus) was the dominant prey in most areas and gizzard shad (Dorosoma cepedianum) replaced menhaden in importance in lower salinity waters. Spot (Leiostomus xanthurus) and other sciaenid fishes and anadromous herrings (Alosa spp.) also contibuted large percentages of striped bass diet. Although pelagic schooling fishes formed the majority of the diet, benthic fishes contributed a higher percentage to the diet than in previous studies of striped bass diet composition.

Assessing the precision of frequency distributions estimated from trawl-survey samples

In trawl surveys a cluster of fish are caught at each station, and fish caught together tend to have more similar characteristics, such as length, age, stomach contents etc., than those in the entire population. When this is the case, the effective sample size for estimates of the frequency distribution of a population characteristic can, therefore, be much smaller than the number of fish sampled during a survey. As examples, it is shown that the effective sample size for estimates of length-frequency distributions generated by trawl surveys conducted in the Barents Sea, off Namibia, and off South Africa is on average approximately one fish per tow. Thus many more fish than necessary are measured at each station (location). One way to increase the effective sample size for these surveys and, hence, increase the precision of the length-frequency estimates, is to reduce tow duration and use the time saved to collect samples at more stations.

Ontogenetic shifts in natural diet during benthic stages of American lobster (Homarus americanus), off the Magdalen Islands

The natural diet of 506 American lobsters (Homarus americanus) ranging from instar V (4 mm cephalothorax length, CL) to the adult stage (112 mm CL) was determined by stomach content analysis for a site in the Magdalen Islands, Gulf of St. Lawrence, eastern Canada. Cluster and factor analyses determined four size groupings of lobsters based on their diet: <7.5 mm, 7.5 to <22.5 mm, 22.5 to <62.5 mm, and ≥62.5 mm CL. The ontogenetic shift in diet with increasing size of lobsters was especially apparent for the three dominant food items: the contribution of bivalves and animal tissue (flesh) to volume of stomach contents decreased from the smallest lobsters (28% and 39%, respectively) to the largest lobsters (2% and 11%, respectively), whereas the reverse trend was seen for rock crab Cancer irroratus (7% in smallest lobsters to 53% in largest lobsters). Large lobsters also ate larger rock crabs than did small lobsters.

Differences in diet of Atlantic bluefin tuna (Thunnus thynnus) at five seasonal feeding grounds on the New England continental shelf

The stomachs of 819 Atlantic bluefin tuna (Thunnus thynnus) sampled from 1988 to 1992 were analyzed to compare dietary differences among five feeding grounds on the New England continental shelf (Jeffreys Ledge, Stellwagen Bank, Cape Cod Bay, Great South Channel, and South of Martha’s Vineyard) where a majority of the U.S. Atlantic commercial catch occurs. Spatial variation in prey was expected to be a primary influence on bluefin tuna distribution during seasonal feeding migrations. Sand lance (Ammodytes spp.), Atlantic herring (Clupea harengus), Atlantic mackerel (Scomber scombrus), squid (Cephalopoda), and bluefish (Pomatomus saltatrix) were the top prey in terms of frequency of occurrence and percent prey weight for all areas combined. Prey composition was uncorrelated between study areas, with the exception of a significant association between Stellwagen Bank and Great South Channel, where sand lance and Atlantic herring occurred most frequently. Mean stomach-contents biomass varied significantly for all study areas, except for Great South Channel and Cape Cod Bay. Jeffreys Ledge had the highest mean stomach-contents biomass (2.0 kg) among the four Gulf of Maine areas and Cape Cod Bay had the lowest (0.4 kg). Diet at four of the five areas was dominated by one or two small pelagic prey and several other pelagic prey made minor contributions. In contrast, half of the prey species found in the Cape Cod Bay diet were demersal species, including the frequent occurrence of the sessile fig sponge (Suberites ficus). Prey size selection was consistent over a wide range of bluefin length. Age 2–4 sand lance and Atlantic herring and age 0–1 squid and Atlantic mackerel were common prey for all sizes of bluefin tuna. This is the first study to compare diet composition of western Atlantic bluefin tuna among discrete feeding grounds during their seasonal migration to the New England continental shelf and to evaluate predator-prey size relationships. Previous studies have not found a common occurrence of demersal species or a pre-dominance of Atlantic herring in the diet of bluefin tuna.

Food habits and consumption rates of common dolphinfish (Coryphaena hippurus) in the eastern Pacific Ocean

An ecosystem approach to fisheries management requires an understanding of the impact of predatory fishes on the underlying prey resources. Defining trophic connections and measuring rates of food consumption by apex predators lays the groundwork for gaining insight into the role of predators and commercial fisheries in influencing food web structure and ecosystem dynamics.We analyzed the stomach contents of 545 common dolphinfish (Coryphaena hippurus) sampled from 74 sets of tuna purse-seine vessels fishing in the eastern Pacific Ocean (EPO) over a 22-month period. Stomach fullness of these dolphinfish and digestion state of the prey indicated that diel feeding periodicity varied by area and may be related to the digestibility and energy content of the prey. Common dolphinfish in the EPO appear to feed at night, as well as during the daytime. We analyzed prey importance by weight, numbers, and frequency of occurrence for five regions of the EPO. Prey importance varied by area. Flyingfishes, epipelagic cephalopods, tetraodontiform fishes, several mesopelagic fishes, Auxis spp., and gempylid fishes predominated in the diet. Ratios of prey length to predator length ranged from 0.014 to 0.720. Consumption-rate estimates averaged 5.6% of body weight per day. Stratified by sex, area, and length class, daily rations ranged up to 9.6% for large males and up to 19.8% for small dolphinfish in the east area (0–15°N, 111°W–coastline). Because common dolphinfish exert substantial predation pressure on several important prey groups, we concluded that their feeding ecology provides important clues to the pelagic food web and ecosystem structure in the EPO.

Opportunistic feeding of longhorn sculpin (Myoxocephalus octodecemspinosus): Are scallop fishery discards an important food subsidy for scavengers on Georges Bank?

There has been much recent interest in the effects of fishing on habitat and non-target species, as well as in protecting certain areas of the seabed from these effects (e.g. Jennings and Kaiser, 1998; Benaka, 1999; Langton and Auster, 1999; Kaiser and de Groot, 2000). As part of an effort to determine the effectiveness of marine closed areas in promoting recovery of commercial species (e.g. haddock, Melanogrammus aegelfinus; sea scallops, Placopecten magellanicus; yellowtail flounder, Limanda ferruginea; cod, Gadus morhua), nontarget species, and habitat, a multidisciplinary research cruise was conducted by the Northeast Fisheries Science Center (NEFSC), National Marine Fisheries Service. The cruise was conducted in closed area II (CA-II) of the eastern portion of Georges Bank during 19–29 June 2000 (Fig. 1). The area has historically produced high landings of scallops but was closed in 1994 principally for groundfish recovery (Fogarty and Murawski, 1998). The southern portion of the area was reopened to scallop fishing from 15 June to 12 November 1999, and again from 15 June to 15 August 2000. While conducting our planned sampling, we observed scallop viscera (the noncalcareous remains from scallops that have been shucked by commercial fishermen at sea) in the stomachs of several fish species at some of these locations, namely little skate (Raja erinacea), winter skate (R. ocellata), red hake (Urophycis chuss), and longhorn sculpin (Myoxocephalus octodecemspinosus). We examined the stomach contents of a known scavenger, the longhorn sculpin, to evaluate and document the extent of this phenomenon.

Vertical and horizontal movements of southern bluefin tuna (Thunnus maccoyii) in the Great Australian Bight observed with ultrasonic telemetry

The vertical and horizontal movements of southern bluefin tuna (SBT), Thunnus maccoyii, in the Great Australian Bight were investigated by ultrasonic telemetry. Between 1992 and 1994, sixteen tuna were tracked for up to 49 h with depth or combined temperature-depth transmitting tags. The average swimming speeds (measured over the ground) over entire tracks ranged from 0.5 to 1.4 m/s or 0.5 to 1.4 body lengths/s. The highest sustained swimming speed recorded was 2.5 m/s for 18 hours. Horizontal movements were often associated with topographical features such as lumps, reefs, islands and the shelf break. They spent long periods of time at the surface during the day (nearly 30%), which would facilitate abundance estimation by aerial survey. At night, they tended to remain just below the surface, but many remained in the upper 10 m throughout the night. SBT were often observed at the thermocline interface or at the surface while travelling. A characteristic feature of many tracks was sudden dives before dawn and after sunset during twilight, followed by a gradual return to their original depth. It is suggested that this is a behavior evolved to locate the scattering layer and its associated prey when SBT are in waters of sufficient depth. SBT maintained a difference between stomach and ambient temperature of up to 9°C.

Development of a new model of feeding strategy analysis of fish incorporating resource availability and use data

A feeding strategy model is proposed using stomach content and resource availability data as a modification to Costello (1990) and Amundsen et al. (1996). Incorporation of feeding electivity index (E) instead of the prey-specific abundance signifies the importance of resource availability in prey selection as well as the predator's ability to specialize, generalize or avoid particular prey items at the individual and population level.

Pathology of mixed infections of saprolegniasis-myxosporidiosis in Indian major carp (Catla catla Ham.)

An outbreak of saprolegniasis in Catla catla in composite carp culture ponds were recorded during winter season. The typical cotton wool growths were observed on whole body surfaces of catla along with sporadic mortality. The fungal invasion was only restricted to skin and no fungal elements were visible in any internal organs after periodic acid schiff staining. On histology, periportal accumulation of mononuclear cells in liver, presence of myxosporidean cysts in antieror kidney, eosinophilic granular cells reaction in submucosa of stomach and intestine, dilated and engorged blood vessels of brain along with sloughing of epidermis and hyperplasia at gill lamellar base were pronounced changes. The possible role of release of Saprolegnia toxin in producing internal organs pathology has been discussed.

Diel feeding patterns, rate of gastric evacuation and foods of Indian sandwhiting, Sillago sihama in Mulki estuary, west coast of India

Diel feeding chronology of sandwhiting, Sillago sihama was examined from stomach collections taken during the months of April, July and December'99 in Mulki estuary along Dakshina Kannada coast, India. Significant differences in mean stomach content weight were found between several consecutive 3 hour periods with peak fullness occurring in early morning and evening hours. The rate of gastric evacuation of natural food (crustacea, polychaetes and fish) was measured in the field was best described by an exponential model, with an estimated evacuation time of 8.0 h at a temperature of 28.5 ± 1.2°C. Stomach content analysis indicated that this species is a carnivore on a wide range of benthic, epibenthic and planktonic prey. The principal food items of S. sihama were crustaceans, polychaetes and fish. Fishes less than 100 mm TL preferred mainly crustaceans while larger ones depends on polychaetes, crustaceans and fish. The feeding activity of S. sihama was influenced by tidal cycle.

A novel proline rich bombesin-related peptide (PR-bombesin) from toad Bombina maxima

A novel bombesin-related peptide was isolated from skin secretions of Chinese red belly toad Bombina maxima. Its primary structure was established as pGlu-Lys-Lys-Pro-Pro-Arg-Pro-Pro-Gln-Trp-Ala-Val-Gly-His-Phe-Met-NH2. The amino-terminal (N-terminal) 8-residue segment comprising four prolines and three basic residues is extensively different from bombesins from other Bombina species. The peptide was thus named proline rich bombesin (PR-bombesin). PR-bumbesin was found to elicit concentration-dependent contractile effects in the rat stomach strip, with both increased potency and intrinsic activity as compared with those of [Leu(13)]bombesin. Analysis of different bombesin cDNA structures revealed that an 8 to 14- nucleotide fragment replacement in the peptide coding region (TGGGGAAT in the cDNAs of multiple bombesin forms from Bombina orientalis and CACCCCGGCCACCC in the cDNA of PR-bombesin) resulted in an unusual Pro-Pro-Arg-Pro-Pro motif in the N-terminal part of PR-bombesin. (C) 2002 Elsevier Science Inc. All rights reserved.

Cloning of novel bombesin precursor cDNAs from skin of Bombina maxima

Amphibian skin is a rich resource of bioactive peptides like proline-rich bombesin from frog Bombina maxima. A novel cDNA clone encoding a precursor protein that comprises proline-rich bombesin and a novel peptide, designated as bombestatin, was isolated from a skin cDNA library of B. maxima. The predicted primary structure of the novel peptide is WEVLLNVALIRLELLSCRSSKDQDQKESCGMHSW, in which two cysteines form a disulfide bond. A BLAST search of databases did not detect sequences with significant similarity. Bombestatin possesses dose-dependent contractile activity on rat stomach strips. The differences between cDNAs encoding PR-bombesin plus bombestatin and PR-bombesin alone are due to fragment insertions located in 3'-coding region and 3'-untranslational region, respectively. (c) 2005 Elsevier B.V. All rights reserved.

Food of two size-groups of the catfish Mystus giulio (Hamilton-Buchanan) in Vemblai canal, Vypeen Island

The stomach contents of two length-groups of the catfish Mystus gulio collected from Vemblai Canal in Vypeen Island (Kochi) were examined by frequency of occurrence and points methods. Analyses using standard indices proved difference in diet composition between the two size-groups.

Rapid detection of white spot syndrome virus (WSSV) of Penaeus monodon by latex agglutination test using monoclonal antibodies

Latex beads were sensitized with monoclonal antibodies (MAb) rose against VP28 of WSSV. The optimum concentration of MAb required to sensitize the latex beads was 125 µg/ml. The sensitized latex beads were used to detect WSSV from PCR-positive stomach tissue homogenates obtained from infected shrimp. Stomach tissue homogenates from WSSV-infected shrimp agglutinated the sensitized latex beads within 10 minutes, while uninfected samples did not produce any agglutination, although non-specific agglutinations were observed in some samples. The analytical sensitivity, analytical specificity, diagnostic sensitivity and diagnostic specificity of the (LAT) agglutination test were assessed. The analytical sensitivity of the test was 40 ng of purified WSSV (2 µg/ml). The sensitized latex beads did not agglutinate with normal shrimp tissue or MBV-infected tissue homogenate. The test has a diagnostic sensitivity of 70 and 45%, respectively, compared to single-step and nested PCR. The diagnostic specificity of the test was 82%. This test is a simple and rapid on-farm test which can be used to corroborate clinical signs for the detection of WSSV in grow-out ponds.