Oligomerization and protein-protein interactions of the sensory histidine kinase DcuS in Escherichia coli

DcuS is a membrane-integral sensory histidine kinase involved in the DcuSR two-component regulatory system in Escherichia coli by regulating the gene expression of C4-dicarboxylate metabolism in response to external stimuli. How DcuS mediates the signal transduction across the membrane remains little understood. This study focused on the oligomerization and protein-protein interactions of DcuS by using quantitative Fluorescence Resonance Energy Transfer (FRET) spectroscopy. A quantitative FRET analysis for fluorescence spectroscopy has been developed in this study, consisting of three steps: (1) flexible background subtraction to yield background-free spectra, (2) a FRET quantification method to determine FRET efficiency (E) and donor fraction (fD = [donor] / ([donor]+[acceptor])) from the spectra, and (3) a model to determine the degree of oligomerization (interaction stoichiometry) in the protein complexes based on E vs. fD. The accuracy and applicability of this analysis was validated by theoretical simulations and experimental systems. These three steps were integrated into a computer procedure as an automatic quantitative FRET analysis which is easy, fast, and allows high-throughout to quantify FRET accurately and robustly, even in living cells. This method was subsequently applied to investigate oligomerization and protein-protein interactions, in particular in living cells. Cyan (CFP) and yellow fluorescent protein (YFP), two spectral variants of green fluorescent protein, were used as a donor-acceptor pair for in vivo measurements. Based on CFP- and YFP-fusions of non-interacting membrane proteins in the cell membrane, a minor FRET signal (E = 0.06 ± 0.01) can be regarded as an estimate of direct interaction between CFP and YFP moieties of fusion proteins co-localized in the cell membrane (false-positive). To confirm if the FRET occurrence is specific to the interaction of the investigated proteins, their FRET efficiency should be clearly above E = 0.06. The oligomeric state of DcuS was examined both in vivo (CFP/YFP) and in vitro (two different donor-acceptor pairs of organic dyes) by three independent experimental systems. The consistent occurrence of FRET in vitro and in vivo provides the evidence for the homo-dimerization of DcuS as full-length protein for the first time. Moreover, novel interactions (hetero-complexes) between DcuS and its functionally related proteins, citrate-specific sensor kinase CitA and aerobic dicarboxylate transporter DctA respectively, have been identified for the first time by intermolecular FRET in vivo. This analysis can be widely applied as a robust method to determine the interaction stoichiometry of protein complexes for other proteins of interest labeled with adequate fluorophores in vitro or in vivo.

Struktur und Funktion des Lipoproteins von Nereis virens (Annelida)

Ein discoidales Lipoprotein aus dem Polychaeten Nereis virens (Annelida) wurde eingehend charakterisiert. Im Vordergrund standen dabei die transportierten Lipide, sowie die Ultrastruktur des Partikels. Das Nereis-Lipoprotein besitzt eine für Invertebraten atypische Lipidzusammensetzung: Außer den Phospholipiden gibt es keine klar dominierende Lipidklasse. Die Charakterisierung der Apolipoproteine zeigt Gemeinsamkeiten mit den Apolipophorinen der Insekten: Wie diese besitzt das Nereis-Lipoprotein zwei Apolipoproteine, die in einer 1:1-Stöchiometrie angeordnet sind. Das größere Protein (ApoNvLp I) ist dabei stärker zum wässrigen Medium exponiert ist als das kleinere (ApoNvLp II). Beide Proteinuntereinheiten sind N-glycosyliert. ApoNvLp II ist zusätzlich noch O-glycosyliert. Bei den Sekundärstrukturen dominieren β-Strukturen (35%) gegenüber α-Helices (14%); 28% waren ungeordnete Strukturen. Die Masse wurde mit verschiedenen Methoden bestimmt: sie liegt zwischen ~800 kDa (Gelfiltration) und ~860 kDa (Analytische Ultrazentrifugation). Der Sedimentationskoeffizient beträgt 9,7 S. Der zelluläre Lipoproteinrezeptor wurde aus einer großen Anzahl von Zellen und Geweben isoliert. Die biochemische Charakterisierung des Rezeptormoleküls zeigte es als ein monomeres, integrales, N- und O-glycosyliertes Membranprotein mit einer Masse von ~114 kDa. Die Bindungscharakteristika (Abhängigkeit von Ca2+, Disulfidbrücken) weisen es als Mitglied der LDLR-Superfamilie aus. In vitro-Inkubationsversuche mit fluoreszenzmarkierten Lipoproteinen zeigten die Aufnahme sowohl in Oocyten als auch in freie Coelomzellen (Elaeocyten) sowie in Spermatogonien- und Tetradenstadien. Auffällig war, dass die Lipide zusammen mit den Apolipoproteinen in die Dottergranula der Eizellen eingelagert wurden und nicht direkt in die Lipidtropfen. Auch bei den Elaeocyten wurden die Lipide nicht direkt in den Lipidtropfen eingelagert. Intakte Lipoproteine konnten per Dichtegradienten-Ultrazentrifugation nur aus Spermatogonien isoliert werden. Die isolierten Lipoproteine hatten die gleiche ‚Morphologie’ wie die aus der Coelomflüssigkeit isolierten, zeigten jedoch sehr viele Peptidfragmente im SDS-Gel, was auf eine beginnende Degradation hinweist. Es wird ein Modell für den Lipidtransport in Nereis virens vorgeschlagen, bei dem den Elaeocyten eine entscheidende Rolle im Lipidstoffwechsel zufällt.

Synthese von Münzmetallsilylen in flüssigem Ammoniak

Im Rahmen der vorliegenden Promotionsarbeit wird das wasserähnliche Lösungsmittel flüssiger Ammoniak verwendet, um die kinetisch instabilen Münzmetallsilyle in hohen Ausbeuten darzustellen. Als Ausgangsverbindungen dienten verschiedene basenfreie Kaliumsilanide, die sich in flüssigem Ammoniak gut lösen ohne nennenswert protolysiert zu werden. Gegenüber konventionellen Synthesen, die in organischen Lösungsmitteln durchgeführt werden, können statt Alkoholate die leicht zugänglichen Münzmetallhalogenide eingesetzt werden. Bei einer Stöchiometrie von 1:1 werden in Abhängigkeit der sterischen Anspruchs des Silylrestes, die cyclischen oder die Ammoniakate der dimeren Kupfer– bzw. Silbersilyle erhalten, während zwei Äquivalente basenfreien Kaliumsilanid und ein Äquivalent Münzmetallhalogenid zu den homologen Homocuprate, -argentate und -aurate führen. Zusätzlich wird die Auswirkung des unterschiedlich sterischen Anspruches der Silylliganden und des gebundenen Münzmetalls auf die Strukturparameter untersucht. Im zweiten Teil dieser Arbeit wird das dargestellte Aurat KAuHyp2 (Hyp = Si(SiMe3)3) mit Trimethylchlorsilan in verschiedenen organischen Lösungsmitteln umgesetzt. In Anhängigkeit von der Stöchiometrie, der Reaktionsdauer, der Temperatur und des verwendeten Lösungsmittels werden erstmalig eine Vielzahl neuer anionischer Goldsilylkomplexe erhalten, genannt sei die Verbindung [K2(Toluol)2][Au4Hyp4], welsches ein Au4-Tetraederskelett mit vier terminalen Hypersilylliganden besitzt. Vom besonderen Interesse ist die Reduktion des Golds. Bemerkenswert sind die zu beobachtenden Silizium-Silizium-Bindungsspaltungen bzw. -Bindungsmetathese bei Raumtemperatur, beispielsweise erkennbar an der Verbindung [K][Au5(Si(SiMe3)2)6]. Auf die Thematik dieser neuartigen strukturell interessanten anionischen Goldsilyle wird in dieser Arbeit näher eingegangen.

Wachstum und Transporteigenschaften dünner Co-basierter Heusler-Filme

For the advancement of spinelectronicsmuch importance is attached to Heusler compounds. Especially compounds with the stoichiometry Co2YZ are supposed to exhibit a large asymmetry between majority and minority electrons at the Fermi edge. Ideally, only majority states are present. This property leads to high magnetoresistive effects. However, the experimental results available at present fall behind the expectations. In particular, a strong reduction of the spin asymmetry with increasing temperature is problematic. For this reason,rnthe investigation of further representatives of this material class as well as optimization of their deposition is required. Therefore, during the course of this work thin Heusler films with the composition Co2Cr0.6Fe0.4Al and Co2Mn1−xFexSi were fabricated. At first, this was accomplished by sputter deposition, which is the standard technique for the preparation of thin Heuslerrnfilms. It resulted also here in samples with high structural order. On the other hand, these films exhibit only a reduced magnetic moment. To improve this situation, a laser ablation system was constructed. The resulting film deposition under ultra-high vacuum led to a clear improvement especially of the magnetic properties. In addition to the improved deposition conditions, this method allowed the flexible variation of the film stoichiometry as well. This possibility was successfully demonstrated in this work by deposition of epitaxial Co2Mn1−xFexSi films. The availableness of these high quality quaternary alloys allowed the systematic investigation of their electronic properties. Band structure calculations predict that the substitution of Mn by Fe lead to a shift of the Fermi energy over the minority energy gap, whereas the density of states remains nearly unchanged. This prediction could by tested by electronic transport measurements. Especially the normal Hall effect, which was measured at these samples, shows a transition from a hole-like charge transport in Co2MnSi to an electron-like transport in Co2FeSi. This is in accordance with corresponding band structure calculations as well as with comparative XMCD experiments. Furthermore, the behavior of the anomalous Hall effect was studied. Here it could be seen, that the effect is influenced by two mechanisms: On the one hand an intrinsic contribution, caused by the topology of the Fermi surface and on the other hand by temperature dependent impurity scattering. These two effects have an opposing influence on the anomalous Hall effect. This can lead to a sign reversal of the anomalous contribution. This behavior has been predicted just recently and was here systematically investigated for the first time for Heusler compounds.

Theoretical study of correlated systems using hybrid functionals

Diese Arbeit unterstreicht das Potential von Hybridfunktionalen (B3LYP) für die Untersuchung einer großen Bandbreite von Systemen. Durch die Einbeziehung der exakten Hartree-Fock Austauschenergie kann B3LYP für molekulare und kristalline Systeme eingesetzt werden. Zum Beispiel können stark korrelierte Systeme mit B3LYP erfolgreich erforscht werden. Die elektronische Struktur von PAHs wurde mit B3LYP Hybriddichtefunktionalen untersucht. Mit der ∆SCF-Methode wurden Elektronenbindungsenergien bestimmt, welche die mit UPS gewonnenen experimentellen Resultate bestätigen und ergänzen. Symmetrieeigenschaften der molekularen Orbitale wurden analysiert, um eine Zuordnung und Einschätzung der zugehörigen Signalstärke zu ermöglichen. Während σ-artige Orbitale nur schwer durch UPS-Messungen an dünnen Filmen detektiert werden können, bieten Rechnungen eine detaillierte Einsicht in die verborgenen Teile der Spektren.rnWeiterhin wurden π−π-Komplexe untersucht, welche von verschiedenen Donor- und Akzeptor-Molekülen gebildet werden. Die Moleküle basieren auf polyzyklischen, aromatischen Kohlenwasserstoffen. Für Ladungstransferkomplexe finden DFT Rechnungen ein Minimum in der Oberfläche der potentiellen Energie. Diese attraktive Wechselwirkung wird durch Coulombanziehung verursacht. Allerdings ist die Coulombanziehung nicht die stärkste Wechselwirkung in Ladungstransferkomplexen. Die Einbeziehung von van der Waals-Korrekturen verbessert den intermolekularen Abstand und die Bindungsenergie.rnEine Verkleinerung der intermolekularen Abstände führt zu einer großen Verschiebung der HOMO- und LUMO-Energie.rnAus der Klasse der kristallinen korrelierten Systeme wurden Rb4O6 und FeSe untersucht. Im Falle von Rb4O6 führen Ladungsordnung und Korrelationen zu einem isolierenden Grundzustand. Das hypothetische druckabhängige Phasendiagramm wurde untersucht. Eine Erhöhung des Drucks führt zu einer vergrößerten Bandlücke. Bei etwa 75 GPa wird die Bandbreite W größer als der Bandabstand U und das System nimmt einen homogen gemischt valenten Zustand mit teilweise besetzten π−π-Orbitalen an. Für Drücke ab 160 GPa wird W sehr viel größer als U und das System wird metallisch.rnIm Fall von FeSe finden wir eine korrelierte und isolierende Phase bei hohen Drücken, während das System bei niedrigen Drücken supraleitendes Verhalten zeigt. Die Berechnungen der Elektronenstruktur mit dem Hybridfunktional B3LYP führt zum korrekten halbleitenden Grundzustand in der NiAs- und MnP-Struktur von FeSe. Die Rolle der Korrelationen, der Stöchiometrie und der Nähe zum Magnetismus wird besprochen. Im Speziellen wird gezeigt, dass die Phase mit NiAs-Struktur starke lokale Korrelationen aufweist, was zu einem halbleitenden Zustand in einem weiten Druckbereich führt.

Structural and biochemical studies of Sporosarcina pasteurii UreE: a nickel-chaperone involved in the urease activation process

Urease is a nickel-dependent enzyme that catalyzes hydrolysis of urea in the last step of organic nitrogen mineralization. Its active site contains a dinuclear center for Ni(II) ions that must be inserted into the apo-enzyme through the action of four accessory proteins (UreD, UreE, UreF, UreG) leading to activation of urease. UreE, acting as a metallo-chaperone, delivers Ni(II) to the preformed complex of apo-urease-UreDFG and has the capability to enhance the GTPase activity of UreG. This study, focused on characterization of UreE from Sporosarcina pasteurii (SpUreE), represents a piece of information on the structure/mobility-function relationships that control nickel binding by SpUreE and its interaction with SpUreG. A calorimetric analysis revealed the occurrence of a binding event between these proteins with positive cooperativity and a stoichiometry consistent with the formation of the (UreE)2-(UreG)2 hetero-oligomer complex. Chemical Shift Perturbations induced by the protein-protein interaction were analyzed using high-resolution NMR spectroscopy, which allowed to characterize the molecular details of the protein surface of SpUreE involved in the complex formation with SpUreG. Moreover, backbone dynamic properties of SpUreE, determined using 15N relaxation analysis, revealed a general mobility in the nanoseconds time-scale, with the fastest motions observed at the C-termini. The latter analysis made it possible for the first time to characterize of the C-terminal portions, known to contain key residues for metal ion binding, that were not observed in the crystal structure of UreE because of disorder. The residues belonging to this portion of SpUreE feature large CSPs upon addition of SpUreG, showing that their chemical environment is directly affected by protein-protein interaction. Metal ion selectivity and affinity of SpUreE for cognate Ni(II) and non cognate Zn(II) metal ions were determined, and the ability of the protein to select Ni(II) over Zn(II), in consistency with the proposed role in Ni(II) cations transport, was established.

Identifizierung und Quantifizierung der Ketocarotinoide in Dauerstadien von Grünalgen und Ketocarotinoidbiosynthese im Modellorganismus Chlamydomonas reinhardtii

Grünalgen bilden zur Überdauerung schlechter Umweltbedingungen Ruhestadien, die sich durch Ausbildung einer festen Zellwand, die Reduktion des Plastiden und die starke Akkumulation von Speicherfetten und Ketocarotinoiden im Zytosol auszeichnen. Obwohl Ketocarotinoide in Grünalgen seit über vierzig Jahren beforscht werden, gab es hierzu noch wenige molekularbiologische Untersuchungen. Im Vorfeld meiner Promotion wurde durch unsere Arbeitsgruppe entdeckt, dass auch der molekular gut zugängliche Modellorganismus Chlamydomonas reinhardtii im Zygotenstadium große Mengen an Ketocarotinoiden bildet. Neben dem zu erwartenden Ketocarotinoid Astaxanthin fanden wir große Mengen des bisher nur in einer Grünalge beschriebenen 4-Ketoluteins. Vorversuche ließen die Vermutung aufkommen, dass dieses Pigment bei der Untersuchung der Pigmentausstattung in Dauerstadien von vielen Grünalgen bisher übersehen wurde. rnIn der vorliegenden Arbeit wurde daher zunächst die Pigmentzusammensetzung von Dauerstadien der bereits gut untersuchten Grünalgen Muriella zofingiensis und Scenedesmus rubescens durch Vergleich mit dem Ketocarotinoidmuster aus Dauerstadien von C. reinhardtii und Fritschiella tuberosa reevaluiert und dabei erstmals das Vorkommen signifikanter Mengen an 4-Ketolutein nachgewiesen. Außerdem zeigte sich, dass die als bisheriger Modellorganismus der Ketocarotinoidbiosynthese in Grünalgen sehr gut untersuchte Alge Haematococcus pluvialis eher eine Ausnahme darstellt, da ihre Dauerstadien als einzige der hier untersuchten Algen nur minimale Mengen von 4 Ketolutein aufwiesen. Diese Beobachtungen machen es sehr wahrscheinlich, dass die Fähigkeit zur Bildung von 4-Ketolutein unter den Grünalgen wesentlich weiter verbreitet ist als bisher angenommen. Das sekundäre Carotinoid 4-Ketolutein kam in den Dauerstadien der Grünalgen neben seiner freien Form ausschließlich als Monoacylester vor, im Gegensatz zu Astaxanthin, das als mono- und diacylierte Form auftrat. rnÜber die Analyse der Pigmentausstattung hinaus konnten die entscheidenden Schritte des Synthesewegs der Ketocarotinoide in C. reinhardtii durch funktionelle Charakterisierung der beteiligten Enzyme in Bakterien aufgeklärt werden. Als Basis für die Charakterisierungen wurde ein umfangreiches Portfolio von carotinogenen E. coli-Bakterien etabliert, darunter α Carotin und Lutein produzierende Stämme, die bisher nicht zur Verfügung standen. Das wurde durch die Klonierung der Lycopinzyklase (OluLCY) aus der Grünalge Ostreococcus lucimarinus möglich, die eine Sonderolle unter den Zyklasen einnimmt, da sie die Lycopin-β-Zyklase und Lycopin-ε-Zyklase in einem Fusionsenzym vereint. Vorteile dieses Fusionsenzyms sind die Expressionskontrolle durch nur einen Promotor und die weitgehend konstante Stöchiometrie seiner Produkte α-Carotin und β-Carotin, was die OluLCY für die biotechnologische Anwendung prädestiniert.rnDie funktionelle Charakterisierung der Carotinoidbiosyntheseenzyme aus C. reinhardtii umfasste das Schlüsselenzym der Ketocarotinoidbiosynthese, die β-Carotin-Ketolase (BKT), sowie die Carotinoid-Hydroxylasen CHYB, CYP97A5 und CYP97C3. Dabei wurde für das BKT-Enzym aus C. reinhardtii nachgewiesen, dass es nicht nur die Ketolierung von β Carotin zu Canthaxanthin und von Zeaxanthin zu Astaxanthin, sondern auch die Bildung der von α-Carotin abgeleiteten Ketocarotinoide wie 4-Keto-α-Carotin und 4 Ketolutein katalysieren kann.rn

Adsorption of macromolecules on interfaces studied by isothermal titration calorimetry

The mixing of nanoparticles with polymers to form composite materials has been applied for decades. They combine the advantages of polymers (e.g., elasticity, transparency, or dielectric properties) and inorganic nanoparticles (e.g., specific absorption of light, magneto resistance effects, chemical activity, and catalysis etc.). Nanocomposites exhibit several new characters that single-phase materials do not have. Filling the polymeric matrix with an inorganic material requires its homogeneous distribution in order to achieve the highest possible synergetic effect. To fulfill this requirement, the incompatibility between the filler and the matrix, originating from their opposite polarity, has to be resolved. A very important parameter here is the strength and irreversibility of the adsorption of the surface active compound on the inorganic material. In this work the Isothermal titration calorimetry (ITC) was applied as a method to quantify and investigate the adsorption process and binding efficiencies in organic-inorganic–hybrid-systems by determining the thermodynamic parameters (ΔH, ΔS, ΔG, KB as well as the stoichiometry n). These values provide quantification and detailed understanding of the adsorption process of surface active molecules onto inorganic particles. In this way, a direct correlation between the adsorption strength and structure of the surface active compounds can be achieved. Above all, knowledge of the adsorption mechanism in combination with the structure should facilitate a more rational design into the mainly empirically based production and optimization of nanocomposites.

Electronic structure and physical properties of Heusler compounds for thermoelectric and spintronic applications

This thesis focuses on synthesis as well as investigations of the electronic structure and properties of Heusler compounds for spintronic and thermoelectric applications.rnThe first part reports on the electronic and crystal structure as well as the mechanical, magnetic, and transport properties of the polycrystalline Heusler compound Co2MnGe. The crystalline structure was examined in detail by extended X-ray absorption fine structure spectroscopy and anomalous X-ray diffraction. The low-temperature magnetic moment agrees well with the Slater-Pauling rule and indicates a half-metallic ferromagnetic state of the compound, as is predicted by ab-initio calculations. Transport measurements and hard X-ray photoelectron spectroscopy (HAXPES) were performed to explain the electronic structure of the compound.rnA major part of the thesis deals with a systematical investigation of Heusler compounds for thermoelectric applications. Few studies have been reported on thermoelectric properties of p-type Heusler compounds. Therefore, this thesis focuses on the search for new p-type Heusler compounds with high thermoelectric efficiency. The substitutional series NiTi1−xMxSn and CoTi1−xMxSb (where M = Sc, V and 0 ≤ x ≤ 0.2) were synthesized and investigated theoretically and experimentally with respect to electronic structure and transport properties. The results show the possibility to create n-type and p-type thermoelectrics within one Heusler compound. The pure compounds showed n-type behavior, while under Sc substitution the system switched to p-type behavior. A maximum Seebeck coefficient of +230 μV/K (at 350 K) was obtained for NiTi0.26Sc0.04Zr0.35Hf0.35Sn, which is one of the highest values for p-type thermoelectric compounds based on Heusler alloys up to now. HAXPES valence band measurement show massive in gap states for the parent compounds NiTiSn, CoTiSb and NiTi0.3Zr0.35Hf0.35Sn. This proves that the electronic states close to the Fermi energy play a key role for the behavior of the transport properties. Furthermore, the electronic structure of the gapless Heusler compounds PtYSb, PtLaBi and PtLuSb were investigated by bulk sensitive HAXPES. The linear behavior of the spectra close to εF proves the bulk origin of Dirac-cone type density of states. Furthermore, a systematic study on the optical and transport properties of PtYSb is presented. The compound exhibits promising thermoelectric properties with a high figure of merit (ZT = 0.2) and a Hall mobility μh of 300 cm2/Vs at 350 K.rnThe last part of this thesis describes the linear dichroism in angular-resolved photoemission from the valence band of NiTi0.9Sc0.1Sn and NiMnSb. High resolution photoelectron spectroscopy was performed with an excitation energy of hν = 7.938 keV. The linear polarization of the photons was changed using an in-vacuum diamond phase retarder. Noticeable linear dichroism is found in the valence bands and this allows for a symmetry analysis of the contributing states. The differences in the spectra are found to be caused by symmetry dependent angular asymmetry parameters, and these occur even in polycrystalline samples without preferential crystallographic orientation.rnIn summary, Heusler compounds with 1:1:1 and 2:1:1 stoichiometry were synthesized and examined by chemical and physical methods. Overall, this thesis shows that the combination of first-principle calculations, transport measurements and high resolution high energy photoelectron spectroscopy analysis is a very powerful tool for the design and development of new materials for a wide range of applications from spintronic applications to thermoelectric applications.rn

Biochemische Untersuchungen des Lichtsammlerprotein (LHCP) im Komplex mit seinem Chaperon, dem plastidären Signalerkennungspartikel cpSRP

Das Lichtsammlerprotein (light harvesting chlorophyll a/b-binding protein, LHCP) ist das Apoprotein des Haupt-Lichtsammelkomplexes (LHCII) und stellt das häufigste Membranprotein der Erde dar. Nicht nur aufgrund seiner Abundanz, sondern auch wegen seiner speziellen Translokation als stark hydrophobes Membranprotein durch hauptsächlich wässrige Milieus von cytosolischen Ribosomen bis in die Thylakoidmembran der Chloroplasten ist der Biogeneseweg dieses Proteins von besonderem Interesse. LHCP ist kernkodiert und wird nach seinem Import in Chloroplasten als Transitkomplex mit dem stromalen Signalerkennungsprotein (cpSRP) zur Thylakoide geleitet. Der cpSRP-Komplex besteht aus dem cpSRP43 mit Chaperonfunktion für das LHCP sowie dem Co-Chaperon cpSRP54, welches eine entscheidende Rolle in der stromalen Zielführung des Transitkomplexes spielt. Sowohl die Proteinkonformation des LHCP während seiner Biogenese als auch der in vivo Faltungsablauf während der Thylakoidinsertion sind noch völlig unklar. Mithilfe der Elektronen-paramagnetischen Resonanz (EPR-)Spektroskopie sollte in dieser Arbeit der Faltungszustand des LHCP im Transitkomplex mit dem cpSRP oder in Teilkomplexen davon ermittelt werden.rnKopplungen von cpSRP43 und LHCP bestätigten, dass das Chaperon als Minimaleinheit zur quantitativen Solubilisierung des Membranproteins genügt. Gelfiltrationschromatographische (GFC-) Untersuchungen solcher Komplexe wiesen jedoch mit einem apparenten MW von ≥ 600 kDa ein sehr hochmolekulares Laufverhalten auf. Variierende Proteinstöchiometrien im Komplex zeigten in densitometrischen Auswertungen eine undefinierte Aggregation. Zusätze von Agenzien zur Vermeidung unspezifischer Wechselwirkungen wie z.B. Detergentien oder auch Salzzugabe zeigten keinen Einfluss auf die Aggregate. Volllängen-Transitkomplexe dagegen wiesen trotz unterschiedlichem Angebot von Einzelproteinen reproduzierbar definierte Stöchiometrien auf. Diese zeigten eine LHCP:cpSRP43-Stöchiometrie von 1,25. Dennoch hatten diese Komplexe mit einem apparenten MW von > 300 kDa einen mindestens dimeren Assemblierungsgrad. Eine Voraussetzung für eindeutige EPR-spektroskopische Distanzmessungen zwischen definierten Positionen im LHCP ist jedoch dessen monomolekularisiertes Vorliegen im Chaperonkomplex. Die Darstellung von ternären Transitkomplexen mit einem zu erwartenden apparenten MW von ~175 kDa war auch durch Zusatz verschiedener Proteinaggregationshemmer nicht möglich. Transitkomplexe mit einer verkürzten Version des cpSRP54 zeigten schließlich eine definierte 1:1-Komplexstöchiometrie bei gleichzeitiger polydisperser Komplexzusammensetzung. Es konnten ~60% dieser sogenannten 54M-Transitkomplexe nach GFC-Daten und densitometrischer Auswertung als potentiell ternär eingeschätzt werden. Darüber hinaus gelang es solche Ansätze durch GFC-Fraktionierung zusätzlich von oligomerisierten Spezies aufzureinigen. Dennoch zeigten die Präparate vor GFC-Fraktionierung ein (noch) zu hohes Aggregationssignal im Hintergrund und nach Fraktionierung ein zu schwaches Signal, um eine eindeutige Aussage der EPR-Daten zuzulassen. Dennoch bietet dieses ausgearbeitete Komplexbildungsprotoll in Verbindung mit der Verwendung von verkürztem cpSRP54 eine solide Basis, um weitere Versuche zu EPR-Messungen an cpSRP-gebundenem LHCP durchzuführen. rn

Deposizione elettrochimica di esacianoferrato di rame tramite un metodo "a due step"; caratterizzazione e valutazione delle prestazioni

In this thesis we have identified two electrochemical procedures for preparing two compounds of copper hexacyanoferrate (CuHCF) films with different compositions and structures. The deposition were carried out using a “two steps” method consisting in electrochemical oxidation of previously deposited metallic copper on carbon substrates (glassy carbon and graphite foil electrodes) in K3[Fe(CN)6] solution. Both films, CuHCF-methodA and CuHCF-methodB, were characterized by cyclic voltammetry (GC) and their study using XANES spectroscopy revealed evidence of different structures. Additionally, insertion and extraction of different cations (Na+, K+, Mg2+, Al3+ and Cs+) were performed and the results indicate that CuHCF-methodA has slightly better performances and operational stability than CuHCF-methodB. Data from galvanostatic charge-discharge tests confirme the latter observation. An application for amperometric detection of H2O2 and SEM micrographs are also reported for both films (method A and B). Comparing these results with a previous work of our research group, seems that the deposition of two different compounds using methodA and methodB is due to the different stoichiometry of ions Cu2+ e [Fe(CN)6]3– created near electrode surface during the dissolution step.

Lactococcus lactis HemW (HemN) is a haem-binding protein with a putative role in haem trafficking

Lactococcus lactis cannot synthesize haem, but when supplied with haem, expresses a cytochrome bd oxidase. Apart from the cydAB structural genes for this oxidase, L. lactis features two additional genes, hemH and hemW (hemN), with conjectured functions in haem metabolism. While it appears clear that hemH encodes a ferrochelatase, no function is known for hemW. HemW-like proteins occur in bacteria, plants and animals, and are usually annotated as CPDHs (coproporphyrinogen III dehydrogenases). However, such a function has never been demonstrated for a HemW-like protein. We here studied HemW of L. lactis and showed that it is devoid of CPDH activity in vivo and in vitro. Recombinantly produced, purified HemW contained an Fe-S (iron-sulfur) cluster and was dimeric; upon loss of the iron, the protein became monomeric. Both forms of the protein covalently bound haem b in vitro, with a stoichiometry of one haem per monomer and a KD of 8 μM. In vivo, HemW occurred as a haem-free cytosolic form, as well as a haem-containing membrane-associated form. Addition of L. lactis membranes to haem-containing HemW triggered the release of haem from HemW in vitro. On the basis of these findings, we propose a role of HemW in haem trafficking. HemW-like proteins form a distinct phylogenetic clade that has not previously been recognized.

Reconstitution of mitochondrial ATP synthase into lipid bilayers for structural analysis

Mitochondrial F(1)F(o)-ATP synthase is a molecular motor that couples the energy generated by oxidative metabolism to the synthesis of ATP. Direct visualization of the rotary action of the bacterial ATP synthase has been well characterized. However, direct observation of rotation of the mitochondrial enzyme has not been reported yet. Here, we describe two methods to reconstitute mitochondrial F(1)F(o)-ATP synthase into lipid bilayers suitable for structure analysis by electron and atomic force microscopy (AFM). Proteoliposomes densely packed with bovine heart mitochondria F(1)F(o)-ATP synthase were obtained upon detergent removal from ternary mixtures (lipid, detergent and protein). Two-dimensional crystals of recombinant hexahistidine-tagged yeast F(1)F(o)-ATP synthase were grown using the supported monolayer technique. Because the hexahistidine-tag is located at the F(1) catalytic subcomplex, ATP synthases were oriented unidirectionally in such two-dimensional crystals, exposing F(1) to the lipid monolayer and the F(o) membrane region to the bulk solution. This configuration opens a new avenue for the determination of the c-ring stoichiometry of unknown hexahistidine-tagged ATP synthases and the organization of the membrane intrinsic subunits within F(o) by electron microscopy and AFM.

Cupiennin 1a, an antimicrobial peptide from the venom of the neotropical wandering spider Cupiennius salei, also inhibits the formation of nitric oxide by neuronal nitric oxide synthase

Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 +/- 0.3 microM. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.

Single-stranded DNA-binding proteins regulate the abundance of LIM domain and LIM domain-binding proteins.

The LIM domain-binding protein Ldb1 is an essential cofactor of LIM-homeodomain (LIM-HD) and LIM-only (LMO) proteins in development. The stoichiometry of Ldb1, LIM-HD, and LMO proteins is tightly controlled in the cell and is likely a critical determinant of their biological actions. Single-stranded DNA-binding proteins (SSBPs) were recently shown to interact with Ldb1 and are also important in developmental programs. We establish here that two mammalian SSBPs, SSBP2 and SSBP3, contribute to an erythroid DNA-binding complex that contains the transcription factors Tal1 and GATA-1, the LIM domain protein Lmo2, and Ldb1 and binds a bipartite E-box-GATA DNA sequence motif. In addition, SSBP2 was found to augment transcription of the Protein 4.2 (P4.2) gene, a direct target of the E-box-GATA-binding complex, in an Ldb1-dependent manner and to increase endogenous Ldb1 and Lmo2 protein levels, E-box-GATA DNA-binding activity, and P4.2 and beta-globin expression in erythroid progenitors. Finally, SSBP2 was demonstrated to inhibit Ldb1 and Lmo2 interaction with the E3 ubiquitin ligase RLIM, prevent RLIM-mediated Ldb1 ubiquitination, and protect Ldb1 and Lmo2 from proteasomal degradation. These results define a novel biochemical function for SSBPs in regulating the abundance of LIM domain and LIM domain-binding proteins.