964 resultados para Transformada Wavelet 1D
Resumo:
We have shown that 44 amino acid residues N-terminal segment of kappa-casein exhibits considerable a-helical structure. This prompted us to investigate the structures of the remaining segments of kappa-casein. Thus, in this study the chemical synthesis and structure elucidation of the peptide 45-87 amino acid residues of kappa-casein is reported. The peptide was assembled using solid phase peptide synthesis methodology on pam resin, cleaved via HF, freeze dried and, after purification, characterised by mass spectrometry (observed m/z 4929; calculated mit 4929.83). The amino acid sequence of the peptide is: CKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKA Its structure elucidation has been carried out using circular dichroism (CD) and nuclear magnetic resonance (NMR) techniques. CD spectrum of the peptide shows it to be a random structure in water but in 30% trifluoroethanol the peptide exhibits considerable structure. The 1D and 2D NMR spectra corroborated the results of CD. The structure elucidation of the peptide using TOCSY and NOESY NMR techniques will be discussed.
Resumo:
This article deals with the efficiency of fractional integration parameter estimators. This study was based on Monte Carlo experiments involving simulated stochastic processes with integration orders in the range]-1,1[. The evaluated estimation methods were classified into two groups: heuristics and semiparametric/maximum likelihood (ML). The study revealed that the comparative efficiency of the estimators, measured by the lesser mean squared error, depends on the stationary/non-stationary and persistency/anti-persistency conditions of the series. The ML estimator was shown to be superior for stationary persistent processes; the wavelet spectrum-based estimators were better for non-stationary mean reversible and invertible anti-persistent processes; the weighted periodogram-based estimator was shown to be superior for non-invertible anti-persistent processes.
Resumo:
The 19-amino acid conopeptide (rho-TIA) was shown previously to antagonize noncompetitively alpha(1B)-adrenergic receptors (ARs). Because this is the first peptide ligand for these receptors, we compared its interactions with the three recombinant human alpha(1)-AR subtypes (alpha(1A), alpha(1B), and alpha(1D)). Radioligand binding assays showed that rho-TIA was 10-fold selective for human alpha(1B)- over alpha(1A)- and alpha(1D)-ARs. As observed with hamster alpha(1B)-ARs, rho-TIA decreased the number of binding sites (B-max) for human alpha(1B)-ARs without changing affinity (K-D), and this inhibition was unaffected by the length of incubation but was reversed by washing. However, rho-TIA had opposite effects at human alpha(1A)-ARs and alpha(1D)-ARs, decreasing KD without changing Bmax, suggesting it acts competitively at these subtypes. rho-TIA reduced maximal NE-stimulated [H-3] inositol phosphate formation in HEK293 cells expressing human alpha(1B)-ARs but competitively inhibited responses in cells expressing alpha(1A)- or alpha(1D)-ARs. Truncation mutants showed that the amino-terminal domains of alpha(1B)- or alpha(1D)-ARs are not involved in interaction with rho-TIA. Alanine-scanning mutagenesis of rho-TIA showed F18A had an increased selectivity for alpha(1B)-ARs, and F18N also increased subtype selectivity. I8A had a slightly reduced potency at alpha(1B)-ARs and was found to be a competitive, rather than noncompetitive, inhibitor in both radioligand and functional assays. Thus rho-TIA noncompetitively inhibits alpha(1B)-ARs but competitively inhibits the other two subtypes, and this selectivity can be increased by mutation. These differential interactions do not involve the receptor amino termini and are not because of the charged nature of the peptide, and isoleucine 8 is critical for its noncompetitive inhibition at alpha(1B)-ARs.
Resumo:
A lignan with a new skeleton named chimarrhinin (1) was isolated from an extract of the leaves of Chimarrhis turbinata, a Rubiaceae plant species. (13)C NMR spectrometric techniques including 1D and 2D experiments and HRESIMS provided unequivocal structural confirmation of this new C(6).C(3) skeleton type. The relative configuration of 1 was established by 2D (1)H-H analysis and J couplings, while its conformation was evaluated through molecular modeling using the RM1 semiempirical method, with the aid of coupling constants obtained by NMR analysis. The antioxidant activity of the new derivative 1 and two known and previously isolated phenolic derivatives (2 and 3) was investigated. An IC(50) value of 7.50 +/- 0.5 mu mol L(-1) was obtained for the new derivative 1, while 2 and 3 showed IC(50) values of 18.60 +/- 0.4 and 18.50 +/- 0.6 mu mol, respectively.
Resumo:
The goal of this paper is to study the global existence of small data solutions to the Cauchy problem for the nonlinear wave equation u(tt) - a(t)(2) Delta u = u(t)(2) - a(t)(2)vertical bar del u vertical bar(2). In particular we are interested in statements for the 1D case. We will explain how the interplay between the increasing and oscillating behavior of the coefficient will influence global existence of small data solutions. Copyright c 2011 John Wiley & Sons, Ltd.
Resumo:
Introduction: Prune belly syndrome (PBS) presents with large-capacity bladders, high compliance and post-void residual volumes. Operative and conservative treatments are controversial. When histologically compared to normal bladder, bladder outlet obstruction results in an up- or down-regulation of adrenoceptors. Our goal was to study the immunoexpression of adrenoceptors in detrusor from patients with PBS. Materials and methods: Bladder domes from PBS patients (n = 14) were studied (PBG). For normal controls, bladder specimens were obtained at adult surgery (n = 13) (CG1) and at child autopsy (n = 5) (CG2). Staining was performed using antibodies to alpha 1a, alpha 1b, alpha 1d and beta 3 adrenoceptors. Five to 10 images were captured on an optic microscope with a digital camera and analysed with Photoshop(R). The immunocyhistochemical index with arbitrary units was calculated and compared. Results: Mean age was 1.28, 64 and 1.41 years for PBG, CG1 and CG2, respectively. The immunohistochemical index with arbitrary units of alpha 1a receptors was 0.06 in PBG, 0.16 in CG1 and 0.14 in CG2 (p = 0.008); of alpha 1b 0.06, 0.06 and 0.07 (p = 0.781); and of alpha 1d 0.04, 0.04 and 0.05 (p = 0.618). Regarding beta 3 the respective values were 0.07, 0.14 and 0.10 (p = 0.378). Conclusion: Our results show a decrease in ala-adrenoceptor immunostaining intensity in detrusor from children with PBS. Further in vitro studies are needed to determine whether these observations are physiologically significant. (C) 2009 Journal of Pediatric Urology Company. Published by Elsevier Ltd. All rights reserved.
Resumo:
Head and neck squamous cell carcinoma (HNSCC) is associated with environmental factors, especially tobacco and alcohol consumption. Most of the carcinogens present in tobacco smoke are converted into DNA-reactive metabolites by cytochrome P450 (CYPs) enzymes and detoxification of these substances is performed by glutathione S-transferases (GSTs). It has been suggested that genetic alterations, such as polymorphisms, play an important role in tumorigenesis and HNSCC progression. The aim of this study was to investigate CYP1A1, CYP1A2, CYP2E1, GSTM1, and GSTT1 polymorphisms as risk factors in HNSCC and their association with clinicopathologic data. The patients comprised 153 individuals with HNSCC (cases) and 145 with no current or previous diagnosis of cancer (controls). Genotyping of the single nucleotide polymorphisms (SNPs) of the CYP1A1, CYP1A2, and CYP2E1 genes was performed by PCR-RFLP and the GSTM1 and GSTT1 copy number polymorphisms (CNPs) were analyzed by PCR-multiplex. As expected, a significant difference was detected for tobacco and alcohol consumption between cases and controls (P < 0.001). It was observed that the CYP1A2*1D (OR = 16.24) variant and GSTM1 null alleles (OR = 0.02) confer increased risk of HNSCC development (P < 0.001). In addition, head and neck cancer alcohol consumers were more frequently associated with the CYP2E1*5B variant allele than control alcohol users (P < 0.0001, OR = 190.6). The CYP1A2*1C polymorphism was associated with tumor recurrence (log-rank test, P = 0.0161). The CYP2E1*5B and GSTM1 null alleles were significantly associated with advanced clinical stages (T3 + T4; P = 0.022 and P = 0.028, respectively). Overall, the findings suggested that the genetic polymorphisms studied are predictors of risk and are also associated with tumor recurrence, since they are important for determining the parameters associated with tumor progression and poor outcomes in HNSCC. (C) 2009 Elsevier Ltd. All rights reserved.
Resumo:
Two new crosses involving four races (races 7, 16, 17, and 25) of the soybean root and stem rot pathogen Phytophthora sojae were established (7/16 cross; 17/25 cross). An F-2 Population derived from each cross was used to determine the genetic basis of avirulence towards 11 different resistance genes in soybean. Avirulence was found to be dominant and determined by a single locus for Avr1b, 1d, 1k, 3b, 4, and 6, as expected for a simple gene-for-gene model. We also observed several cases of segregation, inconsistent with a single dominant gene being solely responsible for avirulence, which suggests that the genetic background of the different crosses can affect avirulence. Avr4 and 6 cosegregated in both the 7/16 and 17/25 crosses and, in the 7/16 cross, Avr1b and 1k were closely linked. Information from segregating RAPD, RFLP, and AFLP markers screened on F-2 progeny from the two new crosses and two crosses described previously (a total of 212 F-2 individuals, 53 from each cross) were used to construct an integrated genetic linkage map of P. sojae. This revised genetic linkage map consists of 386 markers comprising 35 RFLP, 236 RAPD, and 105 AFLP markers, as well as 10 avirulence genes. The map is composed of 21 major linkage groups and seven minor linkage groups covering a total map distance of 1640.4 cM. (C) 2002 Elsevier Science (USA). All rights reserved.
Resumo:
TROST. S. G., R. R. PATE, J. F. SALLIS, P. S. FREEDSON, W. C. TAYLOR, M. DOWDA, and J. SIRARD. Age and gender differences in objectively measured physical activity in youth. Med. Sci. Sports Ererc., Vol. 34, No. 2, pp. 350-355, 2002. Purpose: The purpose of this study was to evaluate age and gender differences in objectively measured physical activity (PA) in a population-based sample of students in grades 1-12. Methods: Participants (185 male, 190 female) wore a CSA 7164 accelerometer for 7 consecutive days. To examine age-related trends. students were grouped as follows: grades 1-3 (N = 90), grades 4-6 (N = 91), grades 7-9 (N = 96). and grades 10-12 (N = 92). Bouts of PA and minutes spent in moderate-to-vigorous PA (MVPA) and vigorous PA (VPA) were examined. Results: Daily MVPA and VPA exhibited a significant inverse relationship with grade level, with the largest differences occurring between grades 1d-3 and 4-6. Boys were more active than girls; however, for overall PA, the magnitudes of the gender differences were modest. Participation in continuous 20-min bouts of PA was low to nonexistent. Conclusion: Our results support the notion that PA declines rapidly during childhood and adolescence and that accelerometers are feasible alternatives to self-report methods in moderately sized population-level surveillance studies.
Resumo:
A crise econ??mica que atravess??vamos foi a mola propulsora para desenvolvermos o projeto Racionaliza????o/Manuten????o da Qualidade Alimentar do Servi??o de Nutri????o e Diet??tica -SND do Hospital Escola. A dificuldade era tanta que nos obrigava a "cortar"os custos de um setor (que fornece uma m??dia mensal de 7.192 refei????es para os plantonistas de servi??o e, principalmente 54.764 refei????es para os pacientes do Hospital) envolvido diretamente, na recupera????o da sa??de dos pacientes. Portanto, era de fundamental import??ncia n??o diminuir a qualidade nutritiva dos alimentos fornecidos. Ent??o, o grande desafio seria: reduzir os custos, sem prejudicar o pronto restabelecimento dos pacientes. Ap??s amplo estudo, conclu??mos que seria necess??rio: simplificar e padronizar os procedimentos operacionais do Servi??o de Nutri????o e Diet??tica (SND); criar mecanismos de controle de acesso aos refeit??rios e encontrar formas alternativas de alimenta????o. Os resultados das medidas implantadas foram surpreendentes. Conseguimos uma redu????o nos custos na ordem de 20% (anexo 1). A mensagem final que gostar??amos de deixar para os nossos colegas Funcion??rios P??blicos ?? que as adversidades s??o essenciais para podermos "mexer" e este ato s?? ocorrer?? se, de fato, precisarmos faz??-lo em nosso benef??cio ou de nossos semelhantes ( o contribuinte que paga seus impostos)
Resumo:
A redefini????o do papel do Estado na sociedade e a conseq??ente transforma????o das Organiza????es P??blicas (OPs) implementadoras deste novo papel t??m sido t??picos-alvo constantes de discuss??o e a????o de governos, tanto em pa??ses desenvolvidos, quanto nos em desenvolvimento. Neste artigo ?? apresentada uma proposta metodol??gica para a transforma????o de OPs, utilizando-se de tecnologia da informa????o (TI) como fator propulsor deste processo de transforma????o. O arcabou??o metodol??gico proposto est??, basicamente, ancorado em duas for??as de mudan??a: uma for??a externa ?? OP ??? Institutional Accountability, e uma for??a interna ?? OP ??? Equipes de Trabalho, que, sinergicamente, encontram-se nos processos de trabalho executados pela OP transformada. As TIs que viabilizam e prov??em suporte ?? implementa????o das for??as externa e interna s??o, respectivamente: Sistema de Informa????o Executivo e Groupware.
Resumo:
Este trabalho tem como objeto de estudo as ações organizativas dos movimentos populares de bairro, enquanto práticas político-pedagógicas. Tomamos como foco, as associações de moradores da região da Grande São Pedro. Apesar de ter ficado conhecida na década de 1980 pela situação de miséria, os moradores dessa região, historicamente perpassada pelo fenômeno da segregação socioespacial, encontraram nas adversidades motivação para a organização do movimento popular como forma de construir sua história e afirmar sua cidadania. Totalmente transformada no que tange à sua urbanização, a região ainda hoje apresenta um cenário adverso para os moradores. Nesse sentido, a importância da organização dos moradores na atualidade é fundamental para lutar contra as situações de opressão que se impõem sobre os mesmos. Entretanto, o quadro que os atuais movimentos populares de bairro desta região apresenta é de reprodução de um modelo político-cultural marcado pelo individualismo, com traços peculiares da formação social brasileira - caracterizada por práticas de centralização, dependência e clientelismo político. Deve-se registrar que apesar de também trazerem traços de lutas e resistência, a forma como atualmente acontecem, com ações em níveis imediatos, esvaziadas de conteúdo político mais amplo, sem articulação com movimentos mais abrangentes, acabam se expressando em um “associativismo individualizado”. Desta feita, reiteramos neste trabalho a necessidade de a classe trabalhadora brasileira retomar, reconstruir espaços que contribuam com a formação de lideranças, com a qualificação das bases desses movimentos, para que seus protagonistas possam consolidar uma prática político-pedagógica fundamentada na educação popular e com isso venham adensar as lutas da classe trabalhadora e somar ao projeto de construção da contra-hegemonia, visando à transformação social. Buscar-se-ia neste sentido, a consolidação de um projeto social mais igualitário, justo e verdadeiramente democrático, no qual seja possível a emancipação humana.
Resumo:
Um complexo de alta fotoluminescência é proposto como marcador óptico para a identificação de resíduos de tiro (GSR). O marcador é o complexo [Eu(PIC)3(NMK)3], de fórmula molecular Eu(C6H2N3O7)3.(C7H13NO)3, que apresenta o íon Eu3+ e os ligantes ácido pícrico (PIC) e n-metil-Ɛ-caprolactama (NMK). Foi realizada a caracterização quimicamente através de espectroscopia de emissão, espectroscopia de infravermelho com transformada de Fourier (FTIR), termogravimetria e análise térmica diferencial (TG/DTA), e espectrometria de massas com ionização por eletrospray e ressonância ciclotrônica de íons por transformada de Fourier (ESI-FT-ICR MS), e, em seguida, foram adicionadas diferentes massas do complexo a munições convencionais (de 2 a 50 mg por cartucho). Após os tiros, o GSR marcado foi visualmente e quimicamente detectado por irradiação UV (ʎ = 395 nm) e ESI-FT-ICR MS, respectivamente. Os resultados mostraram uma fotoluminescência eficiente e duradoura, sendo facilmente visível sobre a superfície do alvo, no ambiente, no cartucho deflagrado, na arma de fogo, e sobre as mãos e braços do atirador quando utilizada massa a partir de 25 mg do marcador em cartuchos .38 e 50 mg em cartuchos .40. Sua toxicidade aguda também foi avaliada empregando-se o Protocolo 423 da Organização para a Cooperação e Desenvolvimento Econômico (OECD) e apresentou DL50 de 1000 mg.kg-1, sendo classificado como de categoria 4 na escala do Sistema Globalmente Harmonizado de Classificação e Rotulagem de Produtos Químicos (GHS), considerado, portanto, de média toxicidade. O composto mostrou ser menos tóxico do que os componentes inorgânicos de munições convencionais (em especial o Pb), justificando o seu emprego como marcador de GSR.
Resumo:
Nesta tese apresenta-se uma nova técnica para solucionar a problemática da estimação de velocidade de embarcações em Radar de Abertura Sintética (SAR). A solução proposta combina duas técnicas já publicadas introduzindo como inovação, a Transformada de Radon. Esta transformada vai permitir estimar a posição do rasto que a embarcação gera à medida que se vai deslocando. Com a posição do objecto calculada é então possível estimar a sua distância ao rasto e assim a velocidade em range. Esta estimativa é limitada pelo Pulse Repetition Frequency (PRF) utilizado na missão SAR. Para a velocidade em azimute é usada uma técnica de Multilook que vai executar uma correlação cruzada entre dois look’s consecutivos. Esta operação permite estimar o desvio que um alvo sofreu de um look para outro. Medindo a frequência central de cada look utilizado é possível estimar a velocidade em azimute.
Resumo:
As características dos vídeos recolhidos num sistema de videovigilância são bastante diferentes dos vídeos recolhidos para filmes. Cada sistema de videovigilância é único. Este trabalho trata a implementação, e especialização, de um algoritmo de codificação de vídeo para um sistema particular de videovigilância composto por três câmaras fixas. O algoritmo desenvolvido tira partido do facto de se conhecer previamente as características físicas e de utilização do local. Utilizando uma codificação inteligente, a codificação das imagens recolhidas depende do dia da semana, hora, câmara e da detecção de alterações na área que se encontra sob vigilância. A especialização é realizada através da configuração do codificador, tendo em conta critérios pré-definidos, de modo a obter uma relação adequada entre a qualidade de imagem e a compressão dos dados. As imagens são independentemente codificadas pela seguinte ordem de operações: transformada discreta do co-seno, quantização, run-length e codificação de Huffman. São armazenadas todas as imagens onde for detectado movimento, não a totalidade da imagem, mas apenas as regiões onde foi detectado movimento sendo utilizado uma decomposição em árvore quaternária. Foi implementado um protótipo de modo a avaliar o desempenho do algoritmo de codificação. O algoritmo, quando comparado com a técnica de codificação usada no sistema de videovigilância, apresenta uma maior taxa de compressão As imagens descodificadas apresentam qualidade suficiente para identificar as pessoas em pontos críticos e seguir os seus movimentos ao longo do corredor.