Anatomia de escapos, folhas e brácteas de Syngonanthus sect. Eulepis (Bong. ex Koern.) Ruhland (Eriocaulaceae)

Estudou-se a anatomia de escapos, folhas e brácteas de 24 espécimes de Syngonanthus sect. Eulepis, que ocorrem nos campos rupestres do Brasil. Os escapos apresentam número variado de costelas, epiderme unisseriada, com células de paredes totalmente espessadas; córtex com esclerênquima e parênquima clorofiliano alternados; endoderme contínua ou descontínua; periciclo estrelado; feixes vasculares colaterais; medula com células de paredes finas ou espessadas. As folhas e as brácteas apresentam epiderme com células de paredes total ou parcialmente espessadas, estômatos na face abaxial, margem com parênquima clorofiliano ou esclerênquima; mesofilo com hipoderme constituída de esclerênquima ou parênquima aqüífero, feixes vasculares colaterais envolvidos externamente pela endoderme e internamente pelo periciclo. Escapos, folhas e brácteas de Syngonanthus sect. Eulepis apresentam células com paredes espessadas e grande quantidade de esclerênquima, provavelmente como resposta adaptativa dessas plantas ao vento e à radiação excessiva comum nos campos rupestres. Epiderme com células de paredes espessadas, estômatos com câmara subestomática não especializada, presença de hipoderme, esclerênquima, e parênquima clorofiliano compacto, caracterizam anatomicamente escapos, folhas e brácteas de Syngonanthus sect. Eulepis. No geral, os caracteres anatômicos não são consistentes para separar os táxons dentro da seção.

Efeitos da temperatura e da movimentação do ar sobre o isolamento térmico do velo de ovinos em câmara climática

Foram utilizados dez ovinos da raça Corriedale - cinco machos e cinco fêmeas com pesos entre 52,2 e 87,6 kg - com o objetivo de avaliar o efeito da combinação da movimentação do ar (0 e 5,0 m/s) com a temperatura do ar (25, 30 e 40ºC) sobre a temperatura retal (T R, ºC), da epiderme (T E, ºC), da superfície do velo (T V, ºC) e do interior do velo (T I, ºC) e a espessura do velo (E V, cm) e suas relações com o isolamento térmico do velo. A presença de vento não teve efeito sobre as variáveis estudadas, o que sugere que fluxo de ar (<5,0 m/s) paralelo ao eixo corporal do animal tem pouco efeito sobre o isolamento térmico do velo, independentemente da temperatura do ar, que se mostrou altamente correlacionada, de forma positiva, com as temperaturas retal, do velo, do interior do velo e da epiderme. Sob temperaturas inferiores a 30ºC, a transferência de calor através do velo ocorreu via condução e convecção livre, enquanto sob altas temperaturas (>40ºC) o fluxo de calor sensível não foi significativa.

Crystallization of bothropstoxin II isolated from the venom of Bothrops jararacussu

A myotoxic phospholipase A(2), bothropstoxin II, which exhibits low hydrolytic activity, was crystallized and X-ray diffraction data were collected to a resolution of 2.2 Angstrom. Preliminary analysis reveals the presence of three molecules in the asymmetric unit. Copyright (C) 1996 Elsevier B.V. Ltd.

A modified ant colony optimization algorithm modeled on tabu-search methods

An earlier model underlying the foraging strategy of a pachycodyla apicalis ant is modified. The proposed algorithm incorporates key features of the tabu-search method in the development of a relatively simple but robust global ant colony optimization algorithm. Numerical results are reported to validate and demonstrate the feasibility and effectiveness of the proposed algorithm in solving electromagnetic (EM) design problems.

Assignment of the disulfide bridges in bothropstoxin-I, a myonecrotic Lys49 PLA(2) homolog from Bothrops jararacussu snake venom

Bothropstoxin-I (BthTX-1), a Lys49 phospholipase A(2) homolog with no apparent catalytic activity, was first isolated from Bothrops jararacussu snake venom and completely sequenced in this laboratory. It is a 121-amino-acid single polypeptide chain, highly myonecrotic, despite its inability to catalyze hydrolysis of egg yolk phospholipids, and has 14 half-cystine residues identified at positions 27, 29, 44, 45, 50, 51, 61, 84, 91, 96, 98, 105, 123, and 131 (numbering according to the conventional alignment including gaps, so that the last residue is Cys 131). In order to access its seven disulfide bridges, two strategies were followed: (1) Sequencing of isolated peptides from (tryptic + SV8) and chymotryptic digests by Edman-dansyl degradation; (2) crystallization of the protein and determination of the crystal structure so that at least two additional disulfide bridges could be identified in the final electron density map. Identification of the disulfide-containing peptides from the enzymatic digests was achieved following the disappearance of the original peptides from the HPLC profile after reduction and carboxymethylation of the digest. Following this procedure, four bridges were initially identified from the tryptic and SV8 digests: Cys50-Cys131, Cys51-Cys98, Cys61-Cys91, and Cys84-Cys96. From the chymotryptic digest other peptides were isolated either containing some of the above bridges, therefore confirming the results from the tryptic digest, or presenting a new bond between Cys27 and Cys123. The two remaining bridges were identified as Cys29-Cys45 and Cys44-Cys105 by determination of the crystal structure, showing that BthTX-1 disulfide bonds follow the normal pattern of group II PLA(2)s.

Crytallization and high-resolution X-ray diffraction data collection of an Asp49 PLA(2) from Bothrops jararacussu venom both in the presence and absence of Ca2+ ions

Snake venom PLA(2)s have been extensively studied due to their role in mediating and disrupting physiological processes such as coagulation, platelet aggregation and myotoxicity. The Ca2+ ion bound to the putative calcium-binding loop is essential for hydrolytic activity. We report the crystallization in the presence and absence of Ca2+ and X-ray diffraction data collection at 1.60 Angstrom (with Ca2+) and 1.36 Angstrom (without Ca2+) of an Asp49 PLA(2) from Bothrops jararacussu venom. The crystals belong to orthorhombic space group C222(1). Initial refinement and electron density analysis indicate significant conformational. changes upon Ca2+ binding. (C) 2004 Elsevier B.V. All fights reserved.

CRYSTALLIZATION AND PRELIMINARY DIFFRACTION DATA OF BOTHROPSTOXIN-I ISOLATED FROM THE VENOM OF BOTHROPS-JARARACUSSU

The myotoxic Lys-49 phospholipase bothropstoxin I was crystallized, and X-ray diffraction data were collected to 3.5 Angstrom resolution. Preliminary analysis reveals the presence of four molecules in the asymmetric unit.

Isolation, characterization and biological activity of acidic phospholipase A(2) isoforms from Bothrops jararacussu snake venom

Acidic phospholipase A(2) (PLA(2)) isoforms in snake venoms, particularly those from Bothrops jararacussu, have not been characterized. This article reports the isolation and partial biochemical, functional and structural characterization of four acidic PLA(2)s (designated SIIISPIIA, SIIISPIIB, SIIISPIIIA and SIIISPIIIB) from this venom. The single chain purified proteins contained 122 amino acid residues and seven disulfide bonds with approximate molecular masses of 15 kDa and isoelectric points of 5.3. The respective N-terminal sequences were: SIIISPIIA-SLWQFGKMIDYVMGEEGAKS; SIIISPIIB-SLWQFGKMIFYTGKNEPVLS; SIIISPIIIA-SLWQFGKMILYVMGGEGVKQ and SIIISPIIIB-SLWQFGKMIFYEMTGEGVL. Crystals of the acidic protein SIIISPIIIB diffracted beyond 1.8 Angstrom resolution. These crystals are monoclinic with unit cell dimensions of a = 40.1 Angstrom, b = 54.2 Angstrom and c = 90.7 Angstrom. The crystal structure has been refined to a crystallographic residual of 16.1% (R-free = 22.9%). Specific catalytic activity (U/mg) of the isolated acidic PLA(2)s were SIIISPIIA = 290.3 U/mg; SIIISPIIB = 279.0 U/mg; SIIISPIIIA = 270.7 U/mg and SIIISPIIIB = 96.5 U/mg. Although their myotoxic activity was low, SIIISPIIA, SIIISPIIIB and SIIISPIIIA showed significant anticoagulant activity. However, there was no indirect hemolytic activity. SIIISPIIIB revealed no anticoagulant, but presented indirect hemolytic activity. With the exception of SIIISPIIIB, which inhibited platelet aggregation, all the others were capable of inducing time-independent edema. Chemical modification with 4-bromophenacyl bromide did not inhibit the induction of edema, but did suppress other activities. (C) 2003 Editions scientifiques et medicales Elsevier SAS. All rights reserved.

Nonforward parton distributions of the pion within an effective single instanton approximation

We develop a relativistic quark model for pion structure, which incorporates the nontrivial structure of the vacuum of quantum chromodynamics as modelled by instantons. Pions are bound states of quarks and the strong quark-pion vertex is determined from an instanton induced effective Lagrangian. The interaction of the constituents of the pion with the external electromagnetic field is introduced in gauge invariant form. The parameters of the model, i.e., effective instanton radius and constituent quark mass, are obtained from the vacuum expectation values of the lowest dimensional quark and gluon operators and the low-energy observables of the pion. We apply the formalism to the calculation of the pion form factor by means of the isovector nonforward parton distributions and find agreement with the experimental data. © 2000 Elsevier Science B.V.

Classification of petroleum well drilling operations with a hybrid particle swarm/ant colony algorithm

This paper describes an investigation of the hybrid PSO/ACO algorithm to classify automatically the well drilling operation stages. The method feasibility is demonstrated by its application to real mud-logging dataset. The results are compared with bio-inspired methods, and rule induction and decision tree algorithms for data mining. © 2009 Springer Berlin Heidelberg.

Avaliação limnológica em um sistema de piscicultura na região de Paranaíta (MT, Brasil)

Pós-graduação em Aquicultura - FCAV

Ecologia termal da jararaca-ilhoa, Bothrops insularis (Serpentes, Viperidae): um estudo em condições naturais

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Morfoanatomia dos capítulos e biologia da polinização de Syngonanthus elegans (Bong.) Ruhland (Eriocaulaceae - Poales)

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Análise de três métodos de estimativa da evapotranspiração de referência para a região de Pradópolis - SP

Pós-graduação em Agronomia (Ciência do Solo) - FCAV

Previsão de ondas geradas por ventos em águas interiores e sua alteração devido à presença de vegetação aquática em margens de lagos

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)