78 resultados para 2 DIMENSIONS


Relevância:

30.00% 30.00%

Publicador:

Resumo:

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Let us consider M a closed smooth connected m-manifold, N a smooth ( 2m-2)-manifold and f: M -> N a continuous map, with m equivalent to 1( 4). We prove that if f*: H(1)(M; Z(2)) -> H(1)(f(M); Z(2)) is injective, then f is homotopic to an immersion. Also we give conditions to a map between manifolds of codimension one to be homotopic to an immersion. This work complements some results of Biasi et al. (Manu. Math. 104, 97-110, 2001; Koschorke in The singularity method and immersions of m-manifolds into manifolds of dimensions 2m-2, 2m-3 and 2m-4. Lecture Notes in Mathematics, vol. 1350. Springer, Heidelberg, 1988; Li and Li in Math. Proc. Camb. Phil. Soc. 112, 281-285, 1992).

Relevância:

30.00% 30.00%

Publicador:

Resumo:

The complete I-V characteristics of SnO(2)-based varistors, particularly of the Pianaro system SCNCr consisting in 98.9%SnO(2)+1%CoO+0.05%Nb(2)O(5)+0.05%Cr(2)O(3), all in mol%, have been seldom reported in the literature. A comparative study at low and high currents of the nonohmic behavior of SCNCr- and ZnO-based varistors (modified Matsuoka system) is proposed in this work. The SCNCr system showed higher nonlinearity coefficients in the whole range of measured current. The electrical breakdown field (E(b)) was twice as high for the SCNCr system (5400 V/cm) than for the ZnO varistor (2600 V/cm) due to a smaller average grain size of the former (4.5 mu m) with respect to the latter (8.5 mu m). Nevertheless, we consider that another important factor responsible for the high E(b) in the SCNCr system is the great number of electrically active interfaces (85%) as determined with electrostatic force microscopy (EFM). It was also established that the SCNCr system might be produced in disks of smaller dimensions than that of commercial ZnO-based product, with a 5.0 cm(-1) minimal area-volume (A/V) ratio. The SCNCr reached the saturation current in a short time because of the high resistivity of the grains, which is five times higher than that of the grains in ZnO-based varistors.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

The effect of changes in left ventricular (LV) shape and dimensions due to acute arterial hypertension induced by mechanical obstruction of the aorta for 10 min on LV mass values estimated by M-mode echocardiogram was studied in 14 anesthetized dogs. Although the systolic pressure increased from 117.5 +/- 19.9 to 175.4 +/- 22.9 mmHg altered ventricular diameter from 2.77 +/- 0.49 cm to 3.17 +/- 0.67 cm (P<0.05) and wall thickness from 0.83 +/- 0.09 to 0.75 +/- 0.09 cm (P<0.05), LV mass estimated before (73.5 +/- 19.1 g) and after (78.3 +/- 26.4 g) hypertension was not significantly different. We demonstrate here for the first time that changes in LV dimensions induced by acute arterial hypertension do not modify LV mass values estimated by the M-mode electrocardiogram method.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Zhaoermiatoxin, an Arg49 phospholipase A(2) homologue from Zhaoermia mangshanensis (formerly Trimeresurus mangshanensis, Ermia mangshanensis) venom is a novel member of the PLA(2)-homologue family that possesses an arginine residue at position 49, probably arising from a secondary Lys49 -> Arg substitution that does not alter the catalytic inactivity towards phospholipids. Like other Lys49 PLA(2) homologues, zhaoermiatoxin induces oedema and strong myonecrosis without detectable PLA(2) catalytic activity. A single crystal with maximum dimensions of 0.2 x 0.2 x 0.5 mm was used for X-ray diffraction data collection to a resolution of 2.05 angstrom using synchrotron radiation and the diffraction pattern was indexed in the hexagonal space group P6(4), with unit-cell parameters a = 72.9, b = 72.9, c = 93.9 angstrom.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

This work is a natural continuation of our recent study in quantizing relativistic particles. There it was demonstrated that, by applying a consistent quantization scheme to the classical model of a spinless relativistic particle as well as to the Berezin-Marinov model of a 3 + 1 Dirac particle, it is possible to obtain a consistent relativistic quantum mechanics of such particles. In the present paper, we apply a similar approach to the problem of quantizing the massive 2 + 1 Dirac particle. However, we stress that such a problem differs in a nontrivial way from the one in 3 + 1 dimensions. The point is that in 2 + 1 dimensions each spin polarization describes different fermion species. Technically this fact manifests itself through the presence of a bifermionic constant and of a bifermionic first-class constraint. In particular, this constraint does not admit a conjugate gauge condition at the classical level. The quantization problem in 2 + 1 dimensions is also interesting from the physical viewpoint (e.g., anyons). In order to quantize the model, we first derive a classical formulation in an effective phase space, restricted by constraints and gauges. Then the condition of preservation of the classical symmetries allows us to realize the operator algebra in an unambiguous way and construct an appropriate Hilbert space. The physical sector of the constructed quantum mechanics contains spin-1/2 particles and antiparticles without an infinite number of negative-energy levels, and exactly reproduces the one-particle sector of the 2 + 1 quantum theory of a spinor field.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

In this brief article we discuss spin-polarization operators and spin-polarization states of 2 + 1 massive Dirac fermions and find a convenient representation by the help of 4-spinors for their description. We stress that in particular the use of such a representation allows us to introduce the conserved covariant spin operator in the 2 + 1 field theory. Another advantage of this representation is related to the pseudoclassical limit of the theory. Indeed, quantization of the pseudoclassical model of a spinning particle in 2 + 1 dimensions leads to the 4-spinor representation as the adequate realization of the operator algebra, where the corresponding operator of a first-class constraint, which cannot be gauged out by imposing the gauge condition, is just the covariant operator previously introduced in the quantum theory.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

From spinor and scalar (2 + 1)-dimensional QED effective actions at finite temperature and density in a constant magnetic field background, we calculate the corresponding virial coefficients for particles in the lowest Landau level. These coefficients depend on a parameter theta related to the time-component of the gauge field, which plays an essential role for large gauge invariance. The variation of the parameter theta might lead to an interpolation between fermionic and bosonic virial coefficients, although these coefficients are singular for theta = pi/2.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Acidic phospholipase A(2) (PLA(2)) isoforms in snake venoms, particularly those from Bothrops jararacussu, have not been characterized. This article reports the isolation and partial biochemical, functional and structural characterization of four acidic PLA(2)s (designated SIIISPIIA, SIIISPIIB, SIIISPIIIA and SIIISPIIIB) from this venom. The single chain purified proteins contained 122 amino acid residues and seven disulfide bonds with approximate molecular masses of 15 kDa and isoelectric points of 5.3. The respective N-terminal sequences were: SIIISPIIA-SLWQFGKMIDYVMGEEGAKS; SIIISPIIB-SLWQFGKMIFYTGKNEPVLS; SIIISPIIIA-SLWQFGKMILYVMGGEGVKQ and SIIISPIIIB-SLWQFGKMIFYEMTGEGVL. Crystals of the acidic protein SIIISPIIIB diffracted beyond 1.8 Angstrom resolution. These crystals are monoclinic with unit cell dimensions of a = 40.1 Angstrom, b = 54.2 Angstrom and c = 90.7 Angstrom. The crystal structure has been refined to a crystallographic residual of 16.1% (R-free = 22.9%). Specific catalytic activity (U/mg) of the isolated acidic PLA(2)s were SIIISPIIA = 290.3 U/mg; SIIISPIIB = 279.0 U/mg; SIIISPIIIA = 270.7 U/mg and SIIISPIIIB = 96.5 U/mg. Although their myotoxic activity was low, SIIISPIIA, SIIISPIIIB and SIIISPIIIA showed significant anticoagulant activity. However, there was no indirect hemolytic activity. SIIISPIIIB revealed no anticoagulant, but presented indirect hemolytic activity. With the exception of SIIISPIIIB, which inhibited platelet aggregation, all the others were capable of inducing time-independent edema. Chemical modification with 4-bromophenacyl bromide did not inhibit the induction of edema, but did suppress other activities. (C) 2003 Editions scientifiques et medicales Elsevier SAS. All rights reserved.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Some nonlinear differential systems in (2+1) dimensions are characterized by means of asymptotic modules involving two poles and a ring of linear differential operators with scalar coefficients.Rational and soliton-like are exhibited. If these coefficients are rational functions, the formalism leads to nonlinear evolution equations with constraints. © 1989.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

The problem of a harmonic oscillator coupling to an electromagnetic potential plus a topological-like (Chern-Simons) massive term, in two-dimensional space, is studied in the light of the symplectic formalism proposed by Faddeev and Jackiw for constrained systems.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

It was earlier shown that an SO(9,1) θα spinor variable can be constructed from RNS matter and ghost fields. θα has a bosonic world-sheet super-partner λα which plays the role of a twistor variable, satisfying λΓμ λ = ∂xμ + iθΓμ ∂θ. For Type IIA superstrings, the left-moving [θL α, λL α] and right-moving [θRα, λRα] can be combined into 32-component SO(10,1) spinors [θA, λA]. This suggests that λAΓAB 11 λB = 2λL αλRα can be interpreted as momentum in the eleventh direction. Evidence for this interpretation comes from the zero-momentum vertex operators of the Type IIA superstring and from consideration of DD-branes. As in the work of Bars, one finds an SO(10,2) structure for the Type IIA superstring and an SO(9, 1) × SO(2, 1) structure for the Type IIB superstring. © 1997 Elsevier Science B.V.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

The solutions of a renormalized BCS equation are studied in three space dimensions in s, p and d waves for finite-range separable potentials in the weak to medium coupling region. In the weak-coupling limit, the present BCS model yields a small coherence length ξ and a large critical temperature, T c, appropriate for some high-T c materials. The BCS gap, T c, ξ and specific heat C s(T c) as a function of zero-temperature condensation energy are found to exhibit potential-independent universal scalings. The entropy, specific heat, spin susceptibility and penetration depth as a function of temperature exhibit universal scaling below T c in p and d waves.