74 resultados para Urease inhibitor
Resumo:
Urease inhibitor (UI) and nitrification inhibitor (NI) have the potential to improve N-use efficiency of applied urea and minimize N losses via gaseous emissions of ammonia (NH 3) to the atmosphere and nitrate (NO3-) leaching into surface and ground water bodies. There is a growing interest in the formulations of coating chemical fertilizers with both UI and NI. However, limited information is available on the combined use of UI and NI applied with urea fertilizer. Therefore the aim of this study was to investigate the effects of treating urea with both UI and NI to minimize NH 3 volatilization. Two experiments were set up in volatilization chambers under controlled conditions to examine this process. In the first experiment, UR was treated with the urease inhibitor NBPT [N-(n-butyl) thiophosphoric acid triamide] at a rate of 1060 mg kg -1 urea and/or with the nitrification inhibitor DCD (dicyandiamide) at rates equivalent to 5 or 10% of the urea N. A randomized experimental design with five treatments and five replicates was used: 1) UR, 2) UR + NBPT, 3) UR + DCD 10%, 4) UR + NBPT + DCD 5%, and 5) UR + NBPT + DCD 10%. The fertilizer treatments were applied to the surface of an acidic Red Latosol soil moistened to 60% of the maximum water retention and placed inside volatilization chambers. Controls chambers were added to allow for NH 3 volatilized from unfertilized soil or contained in the air that swept over the soil surface. The second experiment had an additional treatment with surface-applied DCD. The chambers were glass vessels (1.5 L) fit with air inlet and outlet tubings to allow air to pass over the soil. Ammonia volatilized was swept and carried to a flask containing a boric acid solution to trap the gas and then measured daily by titration with a standardized H 2SO 4 solution. Continuous measurements were recorded for 19 and 23 days for the first and second experiment, respectively. The soil samples were then analyzed for UR-, NH4+-, and NO3--N. Losses of NH 3 by volatilization with unamended UR ranged from 28 to 37% of the applied N, with peak of losses observed the third day after fertilization. NBPT delayed the peak of NH 3 losses due to urease inhibition and reduced NH 3 volatilization between 54 and 78% when compared with untreated UR. Up to 10 days after the fertilizer application, NH 3 losses had not been affected by DCD in the UR or the UR + NBPT treatments; thereafter, NH 3 volatilization tended to decrease, but not when DCD was present. As a consequence, the addition of DCD caused a 5-16% increase in NH 3 volatilization losses of the fertilizer N applied as UR from both the UR and the UR + NBPT treatments. Because the effectiveness of NBPT to inhibit soil urease activity was strong only in the first week, it could be concluded that DCD did not affect the action of NBPT but rather, enhanced volatilization losses by maintaining higher soil NH4+ concentration and pH for a longer time. Depending on the combination of factors influencing NH 3 volatilization, DCD could even offset the beneficial effect of NBPT in reducing NH 3 volatilization losses. © 2012 Elsevier Ltd.
Resumo:
O desenvolvimento de tecnologias que visem a aumentar a eficiência dos fertilizantes nitrogenados é de fundamental importância para a sustentabilidade da agricultura. Assim, este trabalho objetivou avaliar a resposta do algodoeiro a diferentes fontes de nitrogênio (N) em cobertura, aplicadas em sistema plantio direto, no Cerrado, nos anos agrícolas 2008/2009 e 2009/2010. Os tratamentos constituíram-se de três fontes de N (ureia, ureia com inibidor de urease e nitrato de amônio) e dois manejos da adubação de N em cobertura (uma aplicação em V5 e duas aplicações, como se segue: 50% em V5 + 50% em B6), além de uma testemunha (sem N em cobertura). O nitrato de amônio promoveu melhor resultado, nos dois períodos avaliados, enquanto a ureia com inibidor de urease diferiu da ureia comum apenas no primeiro ano. O manejo do N em cobertura propiciou resultados diferentes entre os cultivos, sendo dependente das condições ambientais. Caso ocorra precipitação suficiente para incorporação do N ao solo, pode haver melhores produtividades, quando o adubo de cobertura for aplicado todo na fase V5.
Resumo:
Besides increasing productivity, nitrogen fertilization may have positives effects on seed physiological quality. The objective of this study was to evaluate the effect of different forms and levels of urea in top dressing fertilization on the physiological quality of wheat seed genotypes. Seeds of three wheat genotypes (BRS 208, BRS Pardela and IWT 04008) were evaluated for four levels of nitrogen fertilization (0, 40, 80 and 120 kg.ha-1) in three forms of urea (conventional urea, urea with urease inhibitor and protected urea). The nitrogen fertilization was applied during tillering, 20 days after emergence. The seed nitrogen content, 1000 seed mass, germination and vigor (germination first count, cold test, seedling emergence in the field, dry weight of seedlings, accelerated aging and electrical conductivity) were evaluated. The IWT 04008 line and the cultivar BRS Pardela had seeds with a higher physiological quality than those of the cultivar BRS 208. The forms of urea and levels of nitrogen in topdressing did not affect seed physiological quality of the different wheat genotypes.
Resumo:
Pós-graduação em Agronomia (Produção Vegetal) - FCAV
Resumo:
Pós-graduação em Agronomia - FEIS
Resumo:
Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)
Resumo:
Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)
Resumo:
O efeito da amonização com uréia (5,0% matéria seca) do feno de Brachiaria brizantha, com dois teores de umidade (15 ou 30% de umidade), associado a três fontes de urease (feno de capim Brachiaria decumbens, capim-elefante [Pennisetum purpureum] e leucena [Leucaena leucocephala]), foi avaliado. Foram determinados os teores de proteína bruta (PB), fração solúvel (A), frações de proteína verdadeira solúvel e insolúvel em borato fosfato (B1 e B2), fração de proteína potencialmente degradável (B3) e fração da proteína insolúvel em detergente ácido (C). Avaliaram-se os teores de fibra em detergente neutro (FDN), fibra em detergente ácido (FDA), celulose (CEL), hemicelulose (HEM) e lignina (LIG) e digestibilidade in vitro da matéria seca (DIVMS). O delineamento experimental foi o de blocos inteiramente casualizados, com 10 tratamentos (dois controles, 15 e 30% umidade, sem uréia e sem urease; dois controles, 15 e 30% umidade, com uréia e sem urease; seis combinações de fontes de urease e conteúdo de umidade) e três repetições. A amonização dos fenos com diferentes conteúdos de umidade, associados a fontes de urease, aumentou os teores de PB e da fração A, mas não afetou B1 e B2. Contudo, as frações B3 e C diminuíram em reposta à amonização. A aplicação de uréia nos fenos de 30% de umidade, associados ou não a fontes de urease, diminuiu os teores de FDN. A adição de fontes de urease não alterou os teores dos constituintes da parede celular, quando comparada aos tratamentos amonizados com uréia. Os tratamentos aplicados não proporcionaram efeitos consistentes sobre os teores de FDA e de CEL dos fenos e não afetaram os teores de LIG. A aplicação de uréia associada a 15 ou 30% de umidade foi favorável para aumentar o nitrogênio solúvel do feno de Brachiaria brizantha e diminuir o nitrogênio indisponível para o ruminante.
Resumo:
Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)
Resumo:
Objective: Periodontitis is a well-appreciated example of leukocyte-mediated bone loss and inflammation with pathogenic features similar to those observed in other inflammatory diseases, such as arthritis. Since Tacrolimus, is an immunomodulatory drug used for the treatment of some cases of arthritis, we hypothesized that it may modulate periodontal disease.Design: Using a murine model of ligature-induced periodontal disease, we assessed the effects of daily administrations of Tacrolimus (1 mg/kg body weight) on bone loss, enzymatic (myeloperoxidase) analysis, differential white blood cells counts, airpouch exudate and cytokine expression for 5-30 days.Results: Radiographic, enzymatic (myeloperoxidase) and histological analysis revealed that Tacrolimus reduced the severity of periodontitis. More specifically, Tacrolimus suppressed the expression of serum interleukin (IL-1 beta), tumour necrosis factor (TNF-alpha), IL-6, airpouch exudate PGE(2) and leukocytosis usually observed after the induction of periodontitis. Tacrolimus treatment in periodontitis-induced rats conferred protection against the inflammation-induced tissue and bone loss associated with periodontitis, through a mechanism involving IL-1 beta, TNF-alpha and IL-6.Conclusions: the effects of Tacrolimus on periodontal disease pathogenesis may provide clues to a novel approach to host modulation therapy in destructive periodontal disease. (C) 2007 Elsevier Ltd. All rights reserved.
Resumo:
Many plants are used in traditional medicine as active agents against various effects induced by snakebite. The methanolic extract from Cordia verbenacea (Cv) significantly inhibited paw edema induced by Bothrops jararacussu snake venom and by its main basic phospholipase A(2) homologs, namely bothropstoxins I and II (BthTXs). The active component was isolated by chromatography on Sephadex LH-20 and by RP-HPLC on a C18 column and identified as rosmarinic acid (Cv-RA). Rosmarinic acid is an ester of caffeic acid and 3,4-dihydroxyphenyllactic acid [2-O-cafeoil-3-(3,4-di-hydroxy-phenyl)-R-lactic acid]. This is the first report of RA in the species C. verbenacea ('baleeira', 'whaler') and of its anti-inflammatory and antimyotoxic properties against snake venoms and isolated toxins. RA inhibited the edema and myotoxic activity induced by the basic PLA(2)s BthTX-I and BthTX-II. It was, however, less efficient to inhibit the PLA(2) activity of BthTX-II and, still less, the PLA(2) and edema-inducing activities of the acidic isoform BthA-1-PLA(2), from the same venom, showing therefore a higher inhibitory activity upon basic PLA(2)s. RA also inhibited most of the myotoxic and partially the edema-inducing effects of both basic PLA(2)s, thus reinforcing the idea of dissociation between the catalytic and pharmacological domains. The pure compound potentiated the ability of the commercial equine polyvalent antivenom in neutralizing lethal and myotoxic effects of the crude venom and of isolated PLA(2)s in experimental models. CD data presented here suggest that, after binding, no significant conformation changes occur either in the Cv-RA or in the target PLA(2). A possible model for the interaction of rosmarinic acid with Lys49-PLA(2) BthTX-I is proposed. (c) 2005 Elsevier Ltd. All rights reserved.
Resumo:
An acidic (pI similar to 4.5) phospholipase A(2) (BthA-I-PLA(2)) was isolated from Bothrops jararacussu snake venom by ion-exchange chromatography on a CM-Sepharose column followed by reverse phase chromatography on an RP-HPLC C-18 column. It is an similar to13.7 kDa single chain Asp49 PLA(2) with approximately 122 amino acid residues, 7 disulfide bridges, and the following N-terminal sequence: 'SLWQFGKMINYVMJGESGVLQYLSYGCYCGLGGQGQPTDATDRCCFVHDCC(51). Crystals of this acidic protein diffracted beyond 2.0 Angstrom resolution. These crystals are monoclinic and have unit cell dimensions of a = 33.9, b = 63.8, c = 49.1 Angstrom, and beta = 104.0degrees. Although not myotoxic, cytotoxic, or lethal, the protein was catalytically 3-4 tithes more active than BthTX-II, a basic D49 myotoxic PLA(2) from the same venom and other Bothrops venoms. Although it showed no toxic activity, it was able to induce time-independent edema, this activity being inhibited by EDTA. In addition, BthA-I-PLA(2) caused a hypotensive response in the rat and inhibited platelet aggregation, Catalytic, antiplatelet and other activities were abolished by chemical modification with 4-bromophenacyl bromide, which is known to covalently bind to His48 of the catalytic site. Antibodies raised against crude B. jararacussu venom recognized this acidic PLA(2), while anti-Asp49-BthTX-II recognized it weakly and anti-Lys49-BthTX-I showed the least cross-reaction. These data confirm that myotoxicity does not necessarily correlate with catalytic activity in native PLA(2) homologues and that either of these two activities may exist alone. BthA-I-PLA(2), in addition to representing a relevant molecular model of catalytic activity, is also a promising hypotensive agent and platelet aggregation inhibitor for further studies. (C) 2002 Elsevier B.V. All rights reserved.
Resumo:
Phospholipases A(2) belong to the superfamily of proteins which hydrolyzes the sn-2 acyl groups of membrane phospholipids to release arachidonic acid and lysophospholipids. An acidic phospholipase A(2) isolated from Bothrops juraracussu snake venom presents a high catalytic, platelet aggregation inhibition and hypotensive activities. This protein was crystallized in two oligomeric states: monomeric and dimeric. The crystal structures were solved at 1.79 and 1.90 Angstrom resolution, respectively, for the two states. It was identified a Na+ ion at the center of Ca2+-binding site of the monomeric form. A novel dimeric conformation with the active sites exposed to the solvent was observed. Conformational states of the molecule may be due to the physicochemical conditions used in the crystallization experiments. We suggest dimeric state is one found in vivo. (C) 2004 Elsevier B.V. All rights reserved.