999 resultados para Adler-Sukhumi-87


Relevância:

100.00% 100.00%

Publicador:

Resumo:

Amounts of aerosols transported to the shelf surface were calculated on the basis of in situ measurements of concentrations of eolian matter (insoluble aerosol fraction) and vertical fluxes of settling dust in five areas of the Black Sea shelf from the Danube delta to the Inguri River mouth. More than 8.3 mln t of eolian matter are annually transported from the land over the shelf of the former USSR. At the same time more than 5.4 mln t are supplied to the northwestern shelf area, 1.7 mln t are supplied to the Crimean area, about 0.8 mln t are supplied to the Kerch-Taman' area, and about 0.45 mln t are supplied to the Caucasian area.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

We have shown that 44 amino acid residues N-terminal segment of kappa-casein exhibits considerable a-helical structure. This prompted us to investigate the structures of the remaining segments of kappa-casein. Thus, in this study the chemical synthesis and structure elucidation of the peptide 45-87 amino acid residues of kappa-casein is reported. The peptide was assembled using solid phase peptide synthesis methodology on pam resin, cleaved via HF, freeze dried and, after purification, characterised by mass spectrometry (observed m/z 4929; calculated mit 4929.83). The amino acid sequence of the peptide is: CKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKA Its structure elucidation has been carried out using circular dichroism (CD) and nuclear magnetic resonance (NMR) techniques. CD spectrum of the peptide shows it to be a random structure in water but in 30% trifluoroethanol the peptide exhibits considerable structure. The 1D and 2D NMR spectra corroborated the results of CD. The structure elucidation of the peptide using TOCSY and NOESY NMR techniques will be discussed.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Este artigo analisa os gastos públicos dos 10 maiores municípios dos estados da região Sul do Brasil, revelando a ausência de transparência nos demonstrativos publicados pelas administrações públicas. Assim, propõe um relatório de administração para o setor público baseado no Parecer de Orientação nº15/87 da Comissão de Valores Mobiliários (CVM), como forma de aumentar a transparência das demonstrações contábeis publicadas pela administração pública, atendendo aos princípios de boas práticas de governança.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Encontramos a gregarina Ascocystis chagasi, bem como um nematódeo e um tripanosoma nao identificados, em Lutzomyia evandroi da ilha de São Luis, Maranhão.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

HPSS Guidance on Analysist of Risk/Risk Rating Matrix

Relevância:

20.00% 20.00%

Publicador:

Resumo:

NI Strategy Document 2002 - 2005