(Table 1) Insoluble aerosol concentrations and vertical fluxes at the eastern shelf of the Black Sea during breeze circulation in October 1987

Amounts of aerosols transported to the shelf surface were calculated on the basis of in situ measurements of concentrations of eolian matter (insoluble aerosol fraction) and vertical fluxes of settling dust in five areas of the Black Sea shelf from the Danube delta to the Inguri River mouth. More than 8.3 mln t of eolian matter are annually transported from the land over the shelf of the former USSR. At the same time more than 5.4 mln t are supplied to the northwestern shelf area, 1.7 mln t are supplied to the Crimean area, about 0.8 mln t are supplied to the Kerch-Taman' area, and about 0.45 mln t are supplied to the Caucasian area.

Synthesis and structure elucidation of kappa-casein (45-87) - A two dimensional nuclear magnetic resonance study

We have shown that 44 amino acid residues N-terminal segment of kappa-casein exhibits considerable a-helical structure. This prompted us to investigate the structures of the remaining segments of kappa-casein. Thus, in this study the chemical synthesis and structure elucidation of the peptide 45-87 amino acid residues of kappa-casein is reported. The peptide was assembled using solid phase peptide synthesis methodology on pam resin, cleaved via HF, freeze dried and, after purification, characterised by mass spectrometry (observed m/z 4929; calculated mit 4929.83). The amino acid sequence of the peptide is: CKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKA Its structure elucidation has been carried out using circular dichroism (CD) and nuclear magnetic resonance (NMR) techniques. CD spectrum of the peptide shows it to be a random structure in water but in 30% trifluoroethanol the peptide exhibits considerable structure. The 1D and 2D NMR spectra corroborated the results of CD. The structure elucidation of the peptide using TOCSY and NOESY NMR techniques will be discussed.

Proposta de um modelo de relatório de administração para o setor público baseado no Parecer de Orientação nº 15/87 da Comissão de Valores Mobiliários: um instrumento de governança corporativa para a administração pública

Este artigo analisa os gastos públicos dos 10 maiores municípios dos estados da região Sul do Brasil, revelando a ausência de transparência nos demonstrativos publicados pelas administrações públicas. Assim, propõe um relatório de administração para o setor público baseado no Parecer de Orientação nº15/87 da Comissão de Valores Mobiliários (CVM), como forma de aumentar a transparência das demonstrações contábeis publicadas pela administração pública, atendendo aos princípios de boas práticas de governança.

Hydrachnidae und Halacaridae, bearbeitet von dr. R. Piersig ... und dr. H. Lohmann ... Mit 87 abbildungen.

13

Analysis of functional impairments of the human P2Y 11 nucleotide receptor with the alanine-87 - threonine mutation, and development of novel agonists specific for the human P2Y 11 and P2Y 6 receptors

Magdeburg, Univ., Fak. für Naturwiss., Diss., 2015

Nota sobre a infecção de Lutzomyia evandroi (Diptera: Psychodidae) por Ascocystis chagasi (Adler & Mayrink, 1961) no Estado do Maranhão

Encontramos a gregarina Ascocystis chagasi, bem como um nematódeo e um tripanosoma nao identificados, em Lutzomyia evandroi da ilha de São Luis, Maranhão.

Guidance on Analysis (PDF 87 KB)

HPSS Guidance on Analysist of Risk/Risk Rating Matrix

Dietetic Managers (PDF 87 KB)

NI Strategy Document 2002 - 2005