Synthesis and structure elucidation of kappa-casein (45-87) - A two dimensional nuclear magnetic resonance study

We have shown that 44 amino acid residues N-terminal segment of kappa-casein exhibits considerable a-helical structure. This prompted us to investigate the structures of the remaining segments of kappa-casein. Thus, in this study the chemical synthesis and structure elucidation of the peptide 45-87 amino acid residues of kappa-casein is reported. The peptide was assembled using solid phase peptide synthesis methodology on pam resin, cleaved via HF, freeze dried and, after purification, characterised by mass spectrometry (observed m/z 4929; calculated mit 4929.83). The amino acid sequence of the peptide is: CKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKA Its structure elucidation has been carried out using circular dichroism (CD) and nuclear magnetic resonance (NMR) techniques. CD spectrum of the peptide shows it to be a random structure in water but in 30% trifluoroethanol the peptide exhibits considerable structure. The 1D and 2D NMR spectra corroborated the results of CD. The structure elucidation of the peptide using TOCSY and NOESY NMR techniques will be discussed.

Proposta de um modelo de relatório de administração para o setor público baseado no Parecer de Orientação nº 15/87 da Comissão de Valores Mobiliários: um instrumento de governança corporativa para a administração pública

Este artigo analisa os gastos públicos dos 10 maiores municípios dos estados da região Sul do Brasil, revelando a ausência de transparência nos demonstrativos publicados pelas administrações públicas. Assim, propõe um relatório de administração para o setor público baseado no Parecer de Orientação nº15/87 da Comissão de Valores Mobiliários (CVM), como forma de aumentar a transparência das demonstrações contábeis publicadas pela administração pública, atendendo aos princípios de boas práticas de governança.

Hydrachnidae und Halacaridae, bearbeitet von dr. R. Piersig ... und dr. H. Lohmann ... Mit 87 abbildungen.

13

Analysis of functional impairments of the human P2Y 11 nucleotide receptor with the alanine-87 - threonine mutation, and development of novel agonists specific for the human P2Y 11 and P2Y 6 receptors

Magdeburg, Univ., Fak. für Naturwiss., Diss., 2015

Guidance on Analysis (PDF 87 KB)

HPSS Guidance on Analysist of Risk/Risk Rating Matrix

Dietetic Managers (PDF 87 KB)

NI Strategy Document 2002 - 2005

Cambios en densidad, número y biomasa de la población de de la Concha de Abanico (Argopecten purpuratus) en la Bahía Independencia (Pisco, Perú) durante 1984-87

Se presentan los cambios de densidad y biomasa de la población de de la Concha de Abanico (Argopecten purpuratus) en Bahía Independencia. Los análisis indican que tanto la temperatura como el oxigeno han influenciado en los cambios de los niveles poblacionales.

Friday Facts, February 4, 2011, Vol. 87

Bureau of Nutrition and Health Promotion part of the Iowa Department of Public Health produces of weekly newsletter about the Iowa WIC Program for the State of Iowa citizen.

Trends in mortality from coronary heart and cerebrovascular disease in Switzerland, 1969-87.

Trends in age-specific and age-standardized death certification rates from all ischaemic heart disease and cerebrovascular disease in Switzerland have been analysed for the period 1969-87, i.e. since the introduction of the Eighth Revision of the International Classification of Diseases for coding causes of death. For coronary heart disease, overall age-standardized rates of males in the mid-late 1980's were similar to those in the late 1960's, although some upward trend was evident up to the mid 1970's (with a peak rate of 120.4/100,000, World standard, in 1978) followed by steady declines in more recent years (103.8/100,000 in 1987). These falls were larger in truncated (35 to 64 years) rates. For females, overall age-standardized rates were stable around a value of 40/100,000, while truncated rates tended to decrease, particularly over most recent years, with an overall decline of over 25%. Examination of age-specific trends showed that in both sexes declines at younger ages were already evident in the earlier calendar period, while above age 50 some fall became evident only in most recent years. Thus, in a formal log-linear age/period/cohort model, both a period and a cohort component emerged. In relation to cerebrovascular diseases, the overall declines were around 40% in males (from 67.4 to 41.2/100,000, World standard) and 45% for females (from 56.6 to 31.7/100,000), and were proportionally comparable across subsequent age groups above age 45. The estimates for the age/period/cohort model were thus downwards both for the period and the cohort component although, in such a situation, it is difficult to disentangle the major underlying component.(ABSTRACT TRUNCATED AT 250 WORDS)