993 resultados para Natural peptides
Resumo:
In July 2001, 15 grotesque cyprinid specimens were collected in the Lancangjiang River (of the upper reaches of the Mekong River) in Menglun Town, Xishuanbanna Prefecture, Yunnan Province, PR China. These specimens are characterized by surprising characte
Resumo:
Following brief descriptions of the various phases in the natural life history of the milkfish (Chanos chanos), namely adults, eggs and embryos, larvae, fry and metamorphosis, juveniles and sub-adults, a summary is provided of the life history, providing also a schematic diagram.
Resumo:
Natural food plants of partly provisioned groups of Macaca thibetana included about 196 species belonging to 135 genera and 72 families. The macaques consumed mainly bamboo shoots and fruits for about 2 months in autumn, whereas they relied on active or passive provisions from visitors, a variety of structural parts of plants and a small amount of invertebrates in late spring and summer and ate mainly mature leaves and bark for the rest of the year. About half of the species eaten came from the dense herb and shrub layers. This forest-dwelling species shows a distinctive feeding and foraging pattern in comparison with other macaques, explaining why M. thibetana has the largest body weight of all macaques.
Conditional Moment Closure/Large Eddy Simulation of the Delft-III Natural Gas Non-premixed Jet Flame
Resumo:
The recent re-emergence of tuberculosis, especially the multidrug-resistant cases, has highlighted the importance of screening effective novel drugs against Mycobacterium tuberculosis. In this study, the in vitro activities of small peptides isolated from snake venom were investigated against multidrug-resistant M. tuberculosis. Minimum inhibitory concentrations (MICs) were determined by the Bactec TB-460 radiometric method. A small peptide with the amino acid sequence ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG (designated as vgf-1) from Naja atra (isolated from Yunnan province of China) venom had in vitro activity against clinically isolated multidrug-resistant strains of M. tuberculosis. The MIC was 8.5 mg/l. The antimycobacterial domain of this 60aa peptide is under investigation. (C) 2003 Elsevier Science B.V. and the International Society of Chemotherapy. All rights reserved.
Resumo:
We study two distinctly ordered condensed phases of polypeptide molecules, amyloid fibrils and amyloidlike microcrystals, and the first-order twisting phase transition between these two states. We derive a single free-energy form which connects both phases. Our model identifies relevant degrees of freedom for describing the collective behavior of supramolecular polypeptide structures, reproduces accurately the results from molecular dynamics simulations as well as from experiments, and sheds light on the uniform nature of the dimensions of different peptide fibrils. © 2012 American Physical Society.
Resumo:
The natural ventilation of a building, flanked by others forming urban canyons and driven by the combined forces of wind and thermal buoyancy, has been studied experimentally at small scale. The aim was to improve our understanding of the effect of the urban canyon geometry on passive building ventilation. The steady ventilation of an isolated building was observed to change dramatically, both in terms of the thermal stratification and airflow rate, when placed within the confines of urban canyons. The ventilation flows and internal stratifications observed at small scale are presented for a range of canyon widths (building densities) and wind speeds. Two typical opening arrangements are considered. Flanking an otherwise isolated building with others of similar geometry as in a typical urban canyon was shown to reverse the effect of wind on the thermally-driven ventilation. As a consequence, neglecting the surrounding geometry when designing naturally-ventilated buildings may result in poor ventilation. Further implications are discussed.
Resumo:
The three effectiveness measures based on the ability of a flow to flush buoyancy from a ventilated space proposed by Coffey and Hunt [Ventilation effectiveness measures based on heat removal-part 1. Definitions. Building and Environment, in press, doi:10.1016/j.buildenv.2006.03.016.] are applied to assess and compare two fundamental natural ventilation flows. We focus on the limiting cases of passive displacement and passive mixing ventilation flows during transient conditions. These transient flows occur when, for example, heat is purged from a building at night. Whilst it is widely recognised that mixing flows are less efficient at purging heat than displacement flows, our results indicate that, when a particular zone of a room is considered, displacement ventilation can result in lower effectiveness than mixing ventilation. When a room is considered as a whole, displacement ventilation yields higher effectiveness than mixing ventilation and we quantify these differences in terms of the geometry of the space and opening area. The proposed theoretical predictions are compared with effectiveness deduced from measurements made during laboratory experiments and show good agreement. © 2006 Elsevier Ltd. All rights reserved.
Resumo:
We compare natural ventilation flows established by a range of heat source distributions at floor level. Both evenly distributed and highly localised line and point source distributions are considered. We demonstrate that modelling the ventilation flow driven by a uniformly distributed heat source is equivalent to the flow driven by a large number of localised sources. A model is developed for the transient flow development in a room with a uniform heat distribution and is compared with existing models for localised buoyancy inputs. For large vent areas the flow driven by localised heat sources reaches a steady state more rapidly than the uniformly distributed case. For small vent areas there is little difference in the transient development times. Our transient model is then extended to consider the time taken to flush a neutrally buoyant pollutant from a naturally ventilated room. Again comparisons are drawn between uniform and localised (point and line) heat source geometries. It is demonstrated that for large vent areas a uniform heat distribution provides the fastest flushing. However, for smaller vent areas, localised heat sources produce the fastest flushing. These results are used to suggest a definition for the term 'natural ventilation efficiency', and a model is developed to estimate this efficiency as a function of the room and heat source geometries. © 2006 Elsevier Ltd. All rights reserved.
Resumo:
The transient natural ventilation of an enclosure through vents whose areas vary linearly with time is modelled theoretically. Both displacement and mixing flows are examined and analytical solutions developed. Predictions are presented for the ventilation of a typical office building and compared to existing constant vent area model predictions based on openings of the same average area. The predictions suggest that if the average vent areas are equal in the timedependent and constant area models, the overall time required to ventilate the enclosure is not affected. However, the rate at which heat is removed from the enclosure depends on the initial opening areas and the expansion rates/durations.
Resumo:
We examine the time taken to flush pollutants from a naturally ventilated room. A simple theoretical model is developed to predict the time taken for neutrally-buoyant pollutants to be removed from a room by a flow driven by localised heat inputs; both line and point heat sources are considered. We show that the rate of flushing is a function of the room volume, vent areas ( A) and the distribution, number (n) and strength (B) of the heat sources. We also show that the entire problem can be reduced to a single parameter ( μ) that is a measure of the vent areas, and a dimensionless time ( τ) that is a function of B, V and μ. Small-scale salt-bath experiments were conducted to measure the flushing rates in order to validate our modelling assumptions and predictions. The predicted flushing times show good agreement with the experiments over a wide range of μ. We apply our model to a typical open plan office and lecture theatre and discuss some of the implications of our results. © 2005 Elsevier Ltd. All rights reserved.