999 resultados para Angiolillo, 1734-1784.
Resumo:
Fin dai primi approcci alla città dell'Aquila, quando ancora non la conoscevamo e attraverso libri e articoli in rete cercavamo di capire la sua storia e la sua identità, abbiamo riconosciuto chiaramente quanto fosse importante la sua università. Le testimonianze precedenti il sisma parlavano di una città universitaria con quasi 30000 iscritti in continua crescita, viva e attiva, una città giovane; quelle posteriori il 6 aprile 2009 invece erano le richieste di aiuto da parte di docenti e fuorisede che si rifiutavano di abbandonare quello che per loro era diventato un importante punto di riferimento per la loro vita e la loro formazione. Forse anche perchè noi stesse studentesse, abbiamo fin da subito sentito il dovere di occuparci di questo angoscioso problema, da un lato per essere solidali verso i nostri sfortunati colleghi, dall'altro per non permettere un ulteriore abbandono dell'ateneo aquilano da parte di altri studenti. Lo slogan apparso sui cartelloni di alcuni studenti aquilani durante una manifestazione fatta per sensibilizzare la popolazione sulla loro situazione palesa il loro attaccamento alla città e la loro volontà di continuare a farne parte e partecipare alla sua ricostruzione: "Noi siamo il cuore de L'Aquila". L’Università dell’Aquila vuole tornare nel centro storico. A confermare questa volontà, più volte espressa, c’è l’acquisizione della vecchia struttura dell’ospedale San Salvatore nei pressi della Fontana Luminosa, dove verrà realizzato il nuovo polo umanistico. La nuova sede di Lettere e filosofia, situata nella parte più nuova dell’ex complesso ospedaliero sarà aperta per il prossimo anno accademico e nell'ultima porzione di struttura acquistata si insedierà anche la facoltà di Scienze della formazione. “L’Università deve tornare nel centro storico - ha affermato il rettore Ferdinando di Orio nella conferenza stampa di presentazione dell’iniziativa - perché deve tornare a rappresentare ciò che L’Aquila è, ovvero una città universitaria”. Da qui un percorso di studio che partendo dalla storia della città e della sua università ci ha portato fino alla scelta dell'area, secondo noi la più adatta ad ospitare servizi per gli studenti universitari e permettere un tempestivo approccio al problema. Un'area che si è rivelata piena di potenzialità e per noi possibile punto di riferimento per la rinascita del centro storico aquilano. Dagli studi preliminari svolti è infatti emerso che l'area di progetto è attualmente poco sfruttata benchè la sua posizione sia assolutamente favorevole. Importante è per esempio la vicinanza alla stazione ferroviaria, usata da studenti fuori sede soprattutto della conca aquilana, professori e ospiti che devono raggiungere la città. Il piazzale della stazione ferroviaria, assieme alla via XX Settembre sono poi importanti fermate del servizio urbano ed extraurbano pubblico che collegano l'area con l'università, l'ospedale, e l'autostazione di Collemaggio. Altrettanto rilevante è parsa la prossimità dell'area al centro storico ed il fatto che si presenti agibile nella quasi sua totalità il che permette di poter pensare ad un intervento di ricostruzione tempestivo. Oltre alle mura storiche, la zona di progetto si trova nelle immediate vicinanze di altre due importanti emergenze: la Fontana delle 99 cannelle, uno dei più importanti e più significativi monumenti dell’Aquila e l'edificio dell'ex-mattatoio, struttura di archeologia industriale nella quale il Comune ha scelto di localizzare temporaneamente il Museo Nazionale d'Abruzzo. Attraverso la realizzazione di questo importante spazio espositivo insieme con il restauro della Fontana delle novantanove Cannelle e della Porta Rivera a cura del FAI, sarà possibile ripristinare un polo di attrazione culturale e monumentale. L’operazione assume inoltre un valore simbolico, poiché viene effettuato in un luogo di primaria importanza, legato all’origine stessa della città, che farà da battistrada per la riappropriazione del centro storico. Noi ci affianchiamo quindi a questo importante intervento e alle ultime direttive segnalate dal Comune e dall'Ateneo che dimostrano la loro volontà di riappropriarsi del centro storico, localizzando nell'area i servizi che dopo il sisma risultano necessari affinché gli studenti possano continuare i loro studi nella città e andando a potenziare il sistema museale già presente per creare un importante polo didattico e culturale.
Resumo:
The aims of this research were: - To identify the characteristics, properties and provenance of the building and decorative material found in three Hungarian Roman sites: Nagyharsány, Nemesvámos-Balácapuszta and Aquincum - To provide a database of information on the different sites - To have an overview of main conservation strategies applied in Hungary. Geological studies, macroscopical and microscopical observations, XRD investigations, physical and chemical analyses allowed us to define the characteristics and properties of the different kinds of collected materials. Building stones sampled from Nagyharsány site showed two different kinds of massive limestone belonging to the areas surrounding the villa. Also Building stones sampled from Nemesvámos-Balácapuszta Roman villa proved to be compatible with limestone belonging to local sources. Mural painting fragments show that all samples are units composed of multilayered structures. Mosaic tesserae can be classified as following: -Pale yellow , blackish and pink tesserae are comparable with local limestone; -White tessera, composed of marble, was probably imported from distant regions of the Empire, as the usual practice of Romans. Mortars present different characteristics according to the age, the site and the functions: -Building mortars are generally lime based, white or pale yellow in colour, present a high percentage of aggregates represented by fine sand; -Supporting mortars from both mosaics and mural paintings are reddish or pinkish in colour, due to the presence of high percentage of brick dust and tiles fragments, and present a higher content of MgO. Although the condition of the sites, there is an insignificant content of soluble salts. Database The whole study has allowed us to provide work sheets for each samples, including all characteristics and properties. Furthermore, all sites included in the frame of the research have been described and illustrated on the base of their floor plans, material and construction methodologies. It can be concluded that: 1. In Nagyharsány Archaeological site, it is possible to define a sequence of different construction phases on the base of the study of building material and mortars. The results are comparable with the chronology of the site provided by the archaeologists 2. The material used for construction was of local origin while the more precious ones, used for decorative elements, were probably imported from long distance 3. Construction techniques in Hungary mainly refer to the usual Roman knowledge and practice (Vitruvius); few differences have been found 4. The database will represent an archive for Archaeologists, Historians and Conservators dealing with Roman period in Hungary.
Resumo:
Im Rahmen dieser Arbeit wurden Untersuchungen zur Rückstoßeffekten, sowie Ausheizversuche zur Erforschung struktureller Veränderungen und Änderung der Edelgaskonzentrationen und Ausgasungsmuster in meteoritischen Nanodiamanten durchgeführt. In der ersten Versuchsserie wurden die durch prompte "?"-Strahlung bei Neutronenaktivierung von Brom in terrestrische Detonationsdiamanten und durch den "?"-Zerfall von 22Na in synthetischen und meteoritischen Diamanten verursachten Rückstoßverluste bestimmt. Diese wurden mit theoretischen Verlustwerten, berechnet mit Hilfe der SRIM-Software und der Korngrößenverteilung, verglichen. Im Fall der prompten "?"-Strahlung war der Unterschied signifikant. Hierzu können allerdings systematische Unsicherheiten in den gemessenen Verlusten, wie z.B. unbekannte Br-Verteilung innerhalb der Diamanten beigetragen haben. Die Ergebnisse des zweiten Versuchs bei kleineren Rückstoß-Energien, wie sie auch in der Natur vorkommen würden, zeigten dagegen keinen signifikanten Unterschied. Dies führt zu der Schlussfolgerung, dass weder das „Fehlen“ einiger in Supernovae Typ II gebildeter Radionuklide, wie 26Al, 44Ti, in den Diamanten noch die in einem für die Erklärung des Xe-H vorgeschlagenen Modell benötigte frühzeitige Trennung der Vorläuferkerne stabiler Xe-Isotope von den stabilen Xe-Isotopen durch Rückstoßverluste erklärt werden kann. In der zweiten Versuchsreihe wurden meteoritische Nanodiamantproben bei unterschiedlichen Temperaturen im Vakuum vorgeheizt und danach, um die Heizprodukte zu entfernen, chemisch behandelt. Bei allen Vorheiztemperaturen wurden zwiebelähnliche Strukturen registriert und auch in den nachbehandelten Proben wurden, bedingt durch die wegen Verklumpung der Proben eingeschränkte chemische Behandlung, neben Diamanten unveränderte, oder teilweise zerstörte Umwandlungsprodukte gefunden. Weiterhin wurden Edelgaskonzentrationen und Ausgasungsmuster gemessen, um die durch Vorheizen und chemische Behandlung bedingten Veränderungen im Vergleich zu den Original-Diamanten zu untersuchen. Ein unerwartetes Ergebnis dieser Untersuchungen war, dass die vorgeheizten und chemisch nachbehandelten Proben deutlich niedrigere Ausbeuten im Vergleich zu den nur vorgeheizten zeigten, was darauf hindeutete, dass die während des Vorheizens entstandenen Umwandlungsprodukte, wie z.B. zwiebelähnliche Strukturen, Edelgase zurückhalten konnten, die später (teilweise) durch chemische Behandlung entfernt wurden.
Resumo:
Famille de pasteurs, politiciens et entrepreneurs de Zofingue, attestée pour la première fois en 1527, lorsque leur aïeul Jean, tonnelier originaire de Nîmes, obtint la bourgeoisie de Zofingue. Michael (1521-1605), avoyer, l'un de ses cinq fils, est l'ancêtre de la branche des imprimeurs et éditeurs. Après lui, de nombreux R. consolidèrent durablement l'influence de la famille. A partir du XVIIIe s., divers membres firent des carrières politiques, tels Samuel (1706-1786), avoyer, et Rudolf Friedrich (1805-1886), président de la ville. Les R. furent aussi très liés à l'Eglise. Le fils de Michael, Moritz (1557-1615), fut pasteur et doyen à Zofingue. Jusqu'au XIXe s., la famille compta une trentaine d'ecclésiastiques, essentiellement des pasteurs officiant sur le territoire bernois, tels Johann Heinrich ( -> 3) et Michael ( -> 8). Les conseillers Beat (1712-1778) et Niklaus (1734-1766) furent les premiers R. actifs dans la production protoindustrielle de drap. D'autres négociants suivirent jusqu'au milieu du XIXe s. L'architecte Niklaus Emanuel (1744-1815) construisit l'hôtel de ville de Zofingue (1792-1795) de style baroque tardif. Johann Rudolf ( -> 4) se distingua sous la République helvétique (1798-1803). Samuel (1767-1826), conseiller municipal de Zofingue, créa les armoiries du canton d'Argovie en 1803. Les R. s'affirmèrent sur le plan cantonal avec Karl Ludwig ( -> 6), chancelier, et Arnold ( -> 1), conseiller d'Etat et plusieurs fois landamman, et sur le plan fédéral avec Johann Rudolf ( -> 5), conseiller national, et Gottlieb ( -> 2), conseiller aux Etats et chancelier de la Confédération. Johann Rudolf (1803-1874) fonda, en 1833, l'imprimerie Ringier à Zofingue, reprise par son fils Franz Emil (1837-1898). A partir de 1898, Paul August ( -> 9), représentant de la troisième génération d'imprimeurs, agrandit l'entreprise dont il fit la principale imprimerie et maison d'édition de Suisse. Cette expansion se poursuivit après 1960 sous son fils Hans (1906-2003). Avec les fils de celui-ci, Christoph (naissance1941, dans la firme jusqu'en 1991) et Michael (naissance1949), Ringier devint, à partir de 1985, une entreprise multinationale et multimédia. Bibliographie – F. Schoder, Ortsbürger von Zofingen, 1962 – P. Meier, T. Häussler, Zwischen Masse, Markt und Macht, 2009
Resumo:
Alcohol-induced liver disease (ALD) is a leading cause of nonaccident-related deaths in the United States. Although liver damage caused by ALD is reversible when discovered at the earlier stages, current risk assessment tools are relatively nonspecific. Identification of an early specific signature of ALD would aid in therapeutic intervention and recovery. In this study, the metabolic changes associated with ALD were examined using alcohol-fed male Ppara-null mouse as a model of ALD. Principal components analysis of the mass spectrometry-based urinary metabolic profile showed that alcohol-treated wild-type and Ppara-null mice could be distinguished from control animals without information on history of alcohol consumption. The urinary excretion of ethyl-sulfate, ethyl-beta-d-glucuronide, 4-hydroxyphenylacetic acid, and 4-hydroxyphenylacetic acid sulfate was elevated and that of the 2-hydroxyphenylacetic acid, adipic acid, and pimelic acid was depleted during alcohol treatment in both wild-type and the Ppara-null mice albeit to different extents. However, indole-3-lactic acid was exclusively elevated by alcohol exposure in Ppara-null mice. The elevation of indole-3-lactic acid is mechanistically related to the molecular events associated with development of ALD in alcohol-treated Ppara-null mice. This study demonstrated the ability of a metabolomics approach to identify early, noninvasive biomarkers of ALD pathogenesis in Ppara-null mouse model.
Resumo:
Current therapies to treat prostate cancer are often limited. Since it has been shown that very low concentrations of diphtheria toxin A (DT-A) result in abrogation of protein synthesis and apoptosis of cells, DT-A might serve as an efficient killer in cancer gene therapy. For this purpose we investigated in a quantitative manner using a stereological approach the apoptotic effect of DT-A in androgen receptor (AR) and prostate specific antigen (PSA) expressing cells after tumor formation in both flanks of SCID mice.
Resumo:
In Alagille syndrome, routine follow-up imaging of the liver plays an important role in detecting early parenchymal changes and to evaluate portal hypertension. Modern contrast-enhanced imaging methods not only allow early detection of focal liver lesions, but also enable further characterization of their nature and guide biopsy procedures. We present the US and MR imaging findings of hepatocellular carcinoma and a regenerating nodule in a 3-year-old child with Alagille syndrome.
Resumo:
Reconciliation is the occurrence of friendly behaviour between opponents shortly after an aggressive conflict. In primate groups, reconciliation reduces aggression and post-conflict arousal. Aggression within a group can also increase arousal of bystanders (e.g. increase bystanders’ rates of self-directed behaviour). Since reconciliation reduces aggression between opponents, we tested whether it also reduces self-directed behaviour in bystanders. Following aggression in a captive group of hamadryas baboons, one observer conducted a focal sample on one of the combatants to document reconciliation and a second observer simultaneously conducted a focal sample on a randomly selected bystander. Matched control observations were then collected on the same individuals in a nonaggressive context to obtain baseline levels of behaviour. The self-directed behaviour of bystanders was elevated after witnessing a fight compared to baseline levels. If combatants reconciled aggression, bystander rates of self-directed behaviour significantly decreased. If combatants did not reconcile aggression, bystander rates of self-directed behaviour remained at elevated levels, significantly higher than after reconciliation. If combatants affiliated with partners other than their original opponent, bystander rates of self-directed behaviour did not decrease. The rate of bystander self-directed behaviour after a combatant affiliated with its opponent was significantly lower than the rate after a combatant affiliated with other animals. Witnessing aggression increased arousal in bystanders, and reconciliation between the combatants was accompanied by reduced bystander arousal. The reduction was specific to contexts in which former opponents interacted. We suggest that bystanders recognized the functional significance of this conflict resolution mechanism when it occurred in their group.
Resumo:
Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 +/- 0.3 microM. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.