Análisis del comportamiento de las tuberías de poliéster reforzado con fibra de vidrio con capa de arena

Aunque las primeras fábricas de tubos de poliéster reforzado con fibra de vidrio en España datan del año 1984, no es sino hasta el año 1996 cuando se comienza su utilización masiva como un sustituto de las tuberías de fribrocemento, que ya habían sido prohibidas por la legislación, debido a los efectos cancerígenos de este material. Desde entonces se ha prodigado la utilización de todas las diferentes tipologías de esta clase de tubería, de conformidad a los procesos de fabricación empleados que se encuentran recopilados en el AWWA Manual M45 (Fiberglass Pipe Design), obteniéndose muy diversos resultados. Durante estos años, ha surgido una creciente preocupación en los usuarios de este tipo de tuberías dadas las continuas y numerosas averías en todo el ámbito geográfico. Esto ha promovido el desarrollo de la presente investigaicón, que se ha dividido en dos partes y que ha concluido con la determinación de un nuevo mecanismo específico de fractura. La primera parte se centró en la obtención y desarrollo del modelo teórico que hemos venido a denominar como "Teoría de la Caja Mecánicamente Contaminada", y que está basado en la contaminación o separación por un impacto de dos de las tres capas que forman la tubería, la capa intermedia de arena y la capa más interna o "inner layer". La consecuencia es la disminución del canto resistente, la rotura del inner layer y la entrada de fluido a la capa de arena. Para la evaluación de la magnitud de esta separación se ha desarrollado un modelo analítico que ha determinado la existencia de una relación cuadrática que la rige, y que ha sido verificado mediante ensayos de impacto sobre probetas de tuberías, alcanzando ajustes de hasta el 92%. Así, se ha determinado que impactos de muy baja intensidad, del entorno de 90 a 160 Julios en tuberías Filament Winding continuo PN 16-20 (de 800 a 1000mm) pueden comprometer seriamente la integridad estructural de la tubería sin dejar, en un principio, muesca o traza alguna que pueda alertar del problema. Los siguientes pasos en el estudio se dirigieron a determinar qué otros mecanismos, aparte del golpe, podrían contaminar la tubería y a estudiar el consiguiente avance de la fractura a las capas externas. Se trataba además de analizar la aparición en el tubo de unas misteriosas manchas en forma de "piel de leopardo" y de otros fenómenos aparecidos en las averías como que algunas de las deformaciones de la rotura por presión interna son hacia el interior del tubo y no al revés, como habría sido de esperar a priori. Se optó entonces por comenzar la que ha constituido la segunda parte de la investigación. Para ello se recurrió a realizar ensayos hidráulicos en banco de pruebas a alta presión, cuyos resultados fueron sorprendentes al descubrir que en el proceso se producía la hidrólisis de la resina de poliéster no catalizada que fluía hacia el exterior del tubo. Como consecuencia se llevaron a cabo nuevos ensayos físicos y químicos para estudiar la migración del material y la hidrólisis producida en el proceso de fractura. En este estudio, resultó muy relevante el hecho de sobrepasar o no la presión que producía el desagarro entre las capas del tubo. En definitiva, en esta investigación, que ha constado de estudios analíticos y estudios experimentales, químicos y numéricos, se ha determinado un nuevo mecanismo de fractura que explica gran parte de los fallos acontecidos en las tuberías de poliéster reforzado con fibra de vidrio. Como aplicación se exponen recomendaciones para mejorar el comportamiento mecánico de esta tipología y evitar así los sobrecostes millonarios producidos por su reposición. Numerous and continuous failures in fiberglass reinforced polyester pipes of different companies and manufacturing processes of the AWWA Manual M45 (Fiberglass Pipe Design), have prompted the development of this research, that has concluded with a specific mechanism describing pipe fractures. This research was carried out via two independent studies. The first one is the development of the hypothesis that turned into the Mechanically Contaminated Layer Theory. This theory describes the fracture mchanism which explains a significant part of massive failures due to the existence of a sand layer placed near the neutral axis in the core making the composite very sensitive to impacts in fibreglass reinforced polyester pipes. These failures create interface delamination and consequently fluid can leak into supporting sand backfill thereby iniating the fracture process. In order to assess the delimination magnitude, an analytic method is developed and a squared root law between delamination and energy applied proposed. Vertical blunt ram testts on samples extracted from complete pipes have been carried out to verify this theory, reaching a goodness of fit up to 92%. It is concluded that low energy impacts, around 90-160J in 800-1000mm diameter PN 16-20 continuous filament winding pipes, can seriously compromise their structural integraty with no external trace. The next step in the study was to determine what other mechanism, apart from the brittle hit, could contaminate the pipe and to analyse the consequente advance of the fracture to the external layers. Another aim was to analyse two phenomena occurred in real pipe failures. The first one is the appearance on the tube of "leopard fur" stains on some of the analysed failures, and the other phenomenon is the "inverse fracture", in which the deformations of the failure due to internal pressure are towards the inside of the tube and not the other way round, as it would be expected. It was then chosen to follow a new branch of the investigation by hydraulic high-pressure bench tests that study seepage and load transmission. The results were very surprising as it was discovered that in the process, hydrolysis of the non-catalysed polyester resin occured, flowing towards the outer of the pipe, which entailed the development of chemical and physical tests of the exuded material to study material migration and hydrolysis of the fracture process. In this particular study it was relevant to exceed or not the pressure that produced the rip between the layers of the tube. In conclusion, a new breakage mechanism in FRP pies with sand-filled layer has been found, which explains a high part of the failure global cases. The whole failure process is justified by the Mechanically Contaminated Layer Theory, which has been corroborated by means of analytical, numerical and experimental studies. Several recommendations are also provided in order to improve the mechanical behaviour of this typology and avoid the millionaire overruns generated by its massive failures.

Análisis de secuencias de accidente de pérdida de refrigerante en centrales nucleares de agua a presión mediante la metodología ISA

El accidente de pérdida de refrigerante (LOCA) en un reactor nuclear es uno de los accidentes Base de Diseño más preocupantes y estudiados desde el origen del uso de la tecnología de fisión en la industria productora de energía. El LOCA ocupa, desde el punto de vista de los análisis de seguridad, un lugar de vanguardia tanto en el análisis determinista (DSA) como probabilista (PSA), cuya diferenciada perspectiva ha ido evolucionando notablemente en lo que al crédito a la actuación de las salvaguardias y las acciones del operador se refiere. En la presente tesis se aborda el análisis sistemático de de las secuencias de LOCA por pequeña y mediana rotura en diferentes lugares de un reactor nuclear de agua a presión (PWR) con fallo total de Inyección de Seguridad de Alta Presión (HPSI). Tal análisis ha sido desarrollado en base a la metodología de Análisis Integrado de Seguridad (ISA), desarrollado por el Consejo de Seguridad Nuclear (CSN) y consistente en la aplicación de métodos avanzados de simulación y PSA para la obtención de Dominios de Daño, que cuantifican topológicamente las probabilidades de éxito y daño en función de determinados parámetros inciertos. Para la elaboración de la presente tesis, se ha hecho uso del código termohidráulico TRACE v5.0 (patch 2), avalado por la NRC de los EEUU como código de planta para la simulación y análisis de secuencias en reactores de agua ligera (LWR). Los objetivos del trabajo son, principalmente: (1) el análisis exhaustivo de las secuencias de LOCA por pequeña-mediana rotura en diferentes lugares de un PWR de tres lazos de diseño Westinghouse (CN Almaraz), con fallo de HPSI, en función de parámetros de gran importancia para los transitorios, tales como el tamaño de rotura y el tiempo de retraso en la respuesta del operador; (2) la obtención y análisis de los Dominios de Daño para transitorios de LOCA en PWRs, de acuerdo con la metodología ISA; y (3) la revisión de algunos de los resultados genéricos de los análisis de seguridad para secuencias de LOCA en las mencionadas condiciones. Los resultados de la tesis abarcan tres áreas bien diferenciadas a lo largo del trabajo: (a) la fenomenología física de las secuencias objeto de estudio; (b) las conclusiones de los análisis de seguridad practicados a los transitorios de LOCA; y (c) la relevancia de las consecuencias de las acciones humanas por parte del grupo de operación. Estos resultados, a su vez, son de dos tipos fundamentales: (1) de respaldo del conocimiento previo sobre el tipo de secuencias analizado, incluido en la extensa bibliografía examinada; y (2) hallazgos en cada una de las tres áreas mencionadas, no referidos en la bibliografía. En resumidas cuentas, los resultados de la tesis avalan el uso de la metodología ISA como método de análisis alternativo y sistemático para secuencias accidentales en LWRs. ABSTRACT The loss of coolant accident (LOCA) in nuclear reactors is one of the most concerning and analized accidents from the beginning of the use of fission technology for electric power production. From the point of view of safety analyses, LOCA holds a forefront place in both Deterministic (DSA) and Probabilistic Safety Analysis (PSA), which have significantly evolved from their original state in both safeguard performance credibility and human actuation. This thesis addresses a systematic analysis of small and medium LOCA sequences, in different places of a nuclear Pressurized Water Reactor (PWR) and with total failure of High Pressure Safety Injection (HPSI). Such an analysis has been grounded on the Integrated Safety Assessment (ISA) methodology, developed by the Spanish Nuclear Regulatory Body (CSN). ISA involves the application of advanced methods of simulation and PSA for obtaining Damage Domains that topologically quantify the likelihood of success and damage regarding certain uncertain parameters.TRACE v5.0 (patch 2) code has been used as the thermalhydraulic simulation tool for the elaboration of this work. Nowadays, TRACE is supported by the US NRC as a plant code for the simulation and analysis of sequences in light water reactors (LWR). The main objectives of the work are the following ones: (1) the in-depth analysis of small and medium LOCA sequences in different places of a Westinghouse three-loop PWR (Almaraz NPP), with failed HPSI, regarding important parameters, such as break size or delay in operator response; (2) obtainment and analysis of Damage Domains related to LOCA transients in PWRs, according to ISA methodology; and (3) review some of the results of generic safety analyses for LOCA sequences in those conditions. The results of the thesis cover three separated areas: (a) the physical phenomenology of the sequences under study; (b) the conclusions of LOCA safety analyses; and (c) the importance of consequences of human actions by the operating crew. These results, in turn, are of two main types: (1) endorsement of previous knowledge about this kind of sequences, which is included in the literature; and (2) findings in each of the three aforementioned areas, not reported in the reviewed literature. In short, the results of this thesis support the use of ISA-like methodology as an alternative method for systematic analysis of LWR accidental sequences.

EXPERIÊNCIAS AFETIVAS NO CONTEXTO ORGANIZACIONAL E SEU IMPACTO SOBRE O BEM-ESTAR NO TRABALHO

Em ambiente de elevada pressão, competição e necessidade de criação de diferenciais consistentes que venham contribuir com a longevidade das organizações, nota-se a busca e, às vezes, radicais transformações nos modelos de gestão de negócios e gestão do ser humano no meio empresarial. No campo central dos estudos atuais acerca do comportamento humano e de suas relações com as diversas instituições em que o homem se vê inserido, figuram os esforços voltados à compreensão do papel e valor da contribuição do ser humano ao ambiente de trabalho e fortalecimento das organizações. Crescentes se mostram a preocupação e o entendimento sobre os fatores que impactam o bem-estar geral, o bem-estar no trabalho, a saúde dos trabalhadores e as variáveis emocionais oriundas das relações interpessoais comuns a todo organismo social. A combinação de temas emergentes e ricos em significância como bem-estar no trabalho, satisfação e envolvimento com o trabalho, comprometimento organizacional afetivo, emoções, afetos e sentimentos, caracterizam-se como um vasto e instigante campo de pesquisa para uma adaptação mais ampla do ser humano ao ambiente organizacional. O presente estudo teve como objetivo submeter ao teste empírico as relações entre experiências afetivas no contexto organizacional e três dimensões de bem-estar no trabalho - satisfação no trabalho, envolvimento com o trabalho e comprometimento organizacional afetivo. A amostra foi composta por 253 profissionais de uma indústria metalúrgica de autopeças na grande São Paulo, sendo 213 do sexo masculino e 29 do sexo feminino, com maior freqüência na faixa etária compreendida entre 26 a 30 anos, distribuída entre solteiros e casados. Para a coleta de dados foi utilizado um questionário de auto-preenchimento com quatro escalas que avaliaram afetos positivos e negativos, satisfação no trabalho, envolvimento com o trabalho e comprometimento organizacional afetivo. A análise dos dados foi feita por meio do SPSS, versão 16.0 e diversos sub-programas permitiram realizar análises descritivas bem como calcular modelos de regressão linear para verificar o impacto de afetos positivos e negativos sobre bem-estar no trabalho. Os resultados deste estudo revelaram que o principal preditor das dimensões de bem-estar no trabalho foram os afetos positivos. Assim, parece ser adequado afirmar que bem-estar no trabalho seja um estado psicológico sustentado, em especial, pela vivência de emoções positivas no contexto organizacional. Sugere-se que a promoção da saúde e do bem-estar dentro das organizações sejam focos de estudos futuros, representando valiosa contribuição aos campos de conhecimento da psicologia da saúde e da psicologia organizacional, bem como ao conseqüente fortalecimento dos vínculos entre empresa e trabalhadores.(AU)

EXPERIÊNCIAS AFETIVAS NO CONTEXTO ORGANIZACIONAL E SEU IMPACTO SOBRE O BEM-ESTAR NO TRABALHO

Em ambiente de elevada pressão, competição e necessidade de criação de diferenciais consistentes que venham contribuir com a longevidade das organizações, nota-se a busca e, às vezes, radicais transformações nos modelos de gestão de negócios e gestão do ser humano no meio empresarial. No campo central dos estudos atuais acerca do comportamento humano e de suas relações com as diversas instituições em que o homem se vê inserido, figuram os esforços voltados à compreensão do papel e valor da contribuição do ser humano ao ambiente de trabalho e fortalecimento das organizações. Crescentes se mostram a preocupação e o entendimento sobre os fatores que impactam o bem-estar geral, o bem-estar no trabalho, a saúde dos trabalhadores e as variáveis emocionais oriundas das relações interpessoais comuns a todo organismo social. A combinação de temas emergentes e ricos em significância como bem-estar no trabalho, satisfação e envolvimento com o trabalho, comprometimento organizacional afetivo, emoções, afetos e sentimentos, caracterizam-se como um vasto e instigante campo de pesquisa para uma adaptação mais ampla do ser humano ao ambiente organizacional. O presente estudo teve como objetivo submeter ao teste empírico as relações entre experiências afetivas no contexto organizacional e três dimensões de bem-estar no trabalho - satisfação no trabalho, envolvimento com o trabalho e comprometimento organizacional afetivo. A amostra foi composta por 253 profissionais de uma indústria metalúrgica de autopeças na grande São Paulo, sendo 213 do sexo masculino e 29 do sexo feminino, com maior freqüência na faixa etária compreendida entre 26 a 30 anos, distribuída entre solteiros e casados. Para a coleta de dados foi utilizado um questionário de auto-preenchimento com quatro escalas que avaliaram afetos positivos e negativos, satisfação no trabalho, envolvimento com o trabalho e comprometimento organizacional afetivo. A análise dos dados foi feita por meio do SPSS, versão 16.0 e diversos sub-programas permitiram realizar análises descritivas bem como calcular modelos de regressão linear para verificar o impacto de afetos positivos e negativos sobre bem-estar no trabalho. Os resultados deste estudo revelaram que o principal preditor das dimensões de bem-estar no trabalho foram os afetos positivos. Assim, parece ser adequado afirmar que bem-estar no trabalho seja um estado psicológico sustentado, em especial, pela vivência de emoções positivas no contexto organizacional. Sugere-se que a promoção da saúde e do bem-estar dentro das organizações sejam focos de estudos futuros, representando valiosa contribuição aos campos de conhecimento da psicologia da saúde e da psicologia organizacional, bem como ao conseqüente fortalecimento dos vínculos entre empresa e trabalhadores.(AU)

Metabolic pathway engineering in cotton: Biosynthesis of polyhydroxybutyrate in fiber cells

Alcaligenes eutrophus genes encoding the enzymes, β-ketothiolase (phaA), acetoacetyl-CoA reductase (phaB), and polyhydroxyalkanoate synthase (phaC) catalyze the production of aliphatic polyester poly-d-(−)-3-hydroxybutyrate (PHB) from acetyl-CoA. PHB is a thermoplastic polymer that may modify fiber properties when synthesized in cotton. Endogenous β-ketothiolase activity is present in cotton fibers. Hence cotton was transformed with engineered phaB and phaC genes by particle bombardment, and transgenic plants were selected based on marker gene, β-glucuronidase (GUS), expression. Fibers of 10 transgenic plants expressed phaB gene, while eight plants expressed both phaB and phaC genes. Electron microscopy examination of fibers expressing both genes indicated the presence of electron-lucent granules in the cytoplasm. High pressure liquid chromatography, gas chromatography, and mass spectrometry evidence suggested that the new polymer produced in transgenic fibers is PHB. Sixty-six percent of the PHB in fibers is in the molecular mass range of 0.6 × 106 to 1.8 × 106 Da. The presence of PHB granules in transgenic fibers resulted in measurable changes of thermal properties. The fibers exhibited better insulating characteristics. The rate of heat uptake and cooling was slower in transgenic fibers, resulting in higher heat capacity. These data show that metabolic pathway engineering in cotton may enhance fiber properties by incorporating new traits from other genetic sources. This is an important step toward producing new generation fibers for the textile industry.

Residual delay maps unveil global patterns of atmospheric nonlinearity and produce improved local forecasts

We use residual-delay maps of observational field data for barometric pressure to demonstrate the structure of latitudinal gradients in nonlinearity in the atmosphere. Nonlinearity is weak and largely lacking in tropical and subtropical sites and increases rapidly into the temperate regions where the time series also appear to be much noisier. The degree of nonlinearity closely follows the meridional variation of midlatitude storm track frequency. We extract the specific functional form of this nonlinearity, a V shape in the lagged residuals that appears to be a basic feature of midlatitude synoptic weather systems associated with frontal passages. We present evidence that this form arises from the relative time scales of high-pressure versus low-pressure events. Finally, we show that this nonlinear feature is weaker in a well regarded numerical forecast model (European Centre for Medium-Range Forecasts) because small-scale temporal and spatial variation is smoothed out in the grided inputs. This is significant, in that it allows us to demonstrate how application of statistical corrections based on the residual-delay map may provide marked increases in local forecast accuracy, especially for severe weather systems.

Using O2 to probe membrane immersion depth by 19F NMR

A fluorinated detergent, CF3(CF2)5C2H4-O-maltose, was reconstituted into a lipid bilayer model membrane system to demonstrate the feasibility of determining solvent accessibility and membrane immersion depth of each fluorinated group by 19F NMR. Apolar oxygen, which is known to partition with an increasing concentration gradient toward the hydrophobic membrane interior, exhibits a range of paramagnetic relaxation effects on 19F nuclei, depending on its depth in the membrane. This effect, which is predominately associated with spin-lattice relaxation rates (R1) and chemical shifts, can be amplified greatly with minimal line broadening by increasing the partial pressure of O2 at least 100-fold (i.e., PO2 greater than 20 bar). The differences of longitudinal relaxation rates at 20 bar of oxygen pressure to those under ambient pressure (R120bar − R10) are largest for those fluorine groups expected to be most deeply buried in the membrane bilayer. This result contrasts with the reverse trend, which is observed on addition of a membrane surface-associated paramagnetic species, 4-(N,N-dimethyl-N-hexadecyl) ammonium-2,2,6,6-tetramethylpiperidine-1-oxyl iodide (CAT-16) at ambient pressures. Thus, differential relaxation rates may be observed in 19F-labeled membrane-associated molecules resulting from the addition of apolar oxygen under high pressure. The results demonstrate that the degree of solvent accessibility and membrane immersion depth of specific fluorinated species in membrane-associated macromolecules can be probed by 19F NMR.

Characterization of DNA-Binding Proteins from Pea Mitochondria1

We studied transcription initiation in the mitochondria of higher plants, with particular respect to promoter structures. Conserved elements of these promoters have been successfully identified by in vitro transcription systems in different species, whereas the involved protein components are still unknown. Proteins binding to double-stranded oligonucleotides representing different parts of the pea (Pisum sativum) mitochondrial atp9 were analyzed by denaturation-renaturation chromatography and mobility-shift experiments. Two DNA-protein complexes were detected, which appeared to be sequence specific in competition experiments. Purification by hydroxyapatite, phosphocellulose, and reversed-phase high-pressure liquid chromatography separated two polypeptides with apparent molecular masses of 32 and 44 kD. Both proteins bound to conserved structures of the pea atp9 and the heterologous Oenothera berteriana atp1 promoters and to sequences just upstream. Possible functions of these proteins in mitochondrial promoter recognition are discussed.

Trypanothione overproduction and resistance to antimonials and arsenicals in Leishmania.

Leishmania resistant to arsenicals and antimonials extrude arsenite. Previous results of arsenite uptake into plasma membrane-enriched vesicles suggested that the transported species is a thiol adduct of arsenite. In this paper, we demonstrate that promastigotes of arsenite-resistant Leishmania tarentolae have increased levels of intracellular thiols. High-pressure liquid chromatography of the total thiols showed that a single peak of material was elevated almost 40-fold. The major species in this peak was identified by matrix-assisted laser desorption/ionization mass spectrometry as N1,N8-bis-(glutathionyl)spermidine (trypanothione). The trypanothione adduct of arsenite was effectively transported by the As-thiol pump. No difference in pump activity was observed in wild type and mutants. A model for drug resistance is proposed in which Sb(V)/As(V)-containing compounds, including the antileishmanial drug Pentostam, are reduced intracellularly to Sb(III)/As(III), conjugated to trypanothione, and extruded by the As-thiol pump. The rate-limiting step in resistance is proposed to be formation of the metalloid-thiol pump substrates, so that increased synthesis of trypanothione produces resistance. Increased synthesis of the substrate rather than an increase in the number of pump molecules is a novel mechanism for drug resistance.

Purification and characterization of a luminal cholecystokinin-releasing factor from rat intestinal secretion.

Cholecystokinin (CCK) secretion in rats and humans is inhibited by pancreatic proteases and bile acids in the intestine. It has been hypothesized that the inhibition of CCK release caused by pancreatic proteases is due to proteolytic inactivation of a CCK-releasing peptide present in intestinal secretion. To purify the putative luminal CCK-releasing factor (LCRF), intestinal secretions were collected by perfusing a modified Thiry-Vella fistula of jejunum in conscious rats. From these secretions, the peptide was concentrated by ultrafiltration followed by low-pressure reverse-phase chromatography and purified by reverse-phase high-pressure liquid chromatography. Purity was confirmed by high-performance capillary electrophoresis. Fractions were assayed for CCK-releasing activity by their ability to stimulate pancreatic protein secretion when infused into the proximal small intestine of conscious rats. Partially purified fractions strongly stimulated both pancreatic secretion and CCK release while CCK receptor blockade abolished the pancreatic response. Amino acid analysis and mass spectral analysis showed that the purified peptide is composed of 70-75 amino acid residues and has a mass of 8136 Da. Microsequence analysis of LCRF yielded an amino acid sequence for 41 residues as follows: STFWAYQPDGDNDPTDYQKYEHTSSPSQLLAPGDYPCVIEV. When infused intraduodenally, the purified peptide stimulated pancreatic protein and fluid secretion in a dose-related manner in conscious rats and significantly elevated plasma CCK levels. Immunoaffinity chromatography using antisera raised to synthetic LCRF-(1-6) abolished the CCK releasing activity of intestinal secretions. These studies demonstrate, to our knowledge, the first chemical characterization of a luminally secreted enteric peptide functioning as an intraluminal regulator of intestinal hormone release.

Estratégias para conservação de carne armazenada sob refrigeração: embalagem em atmosfera modificada e processamento em alta pressão

A busca por produtos mais saudáveis e minimamente processados tem levado indústrias e pesquisadores a estudarem novas formas de preservação de alimentos. Os objetivos deste trabalho foram: 1) avaliar o efeito da embalagem com atmosfera modificada (ATM) na preservação de lombo ovino armazenado sob refrigeração e 2) Avaliar o efeito do processamento em alta pressão na conservação de carne bovina marinada e com teor de sódio reduzido. Em ambas as pesquisas, músculos Longissimus lumborum foram submetidos à contagem microbiana, avaliação de cor, pH, oxidação lipídica (TBARS), perdas por cocção (PPC) e força de cisalhamento. Para o estudo do efeito da embalagem em atmosfera modificada, as amostras foram acondicionadas em cinco sistemas de ATM, 15% O2 + 85% CO2; 30% de O2 + 70% de CO2; 45% de O2 + 55% de CO2; 60% de O2 + 40% de CO2 e Vácuo (controle) e armazenadas a 1°C durante 21 dias. As análises de cor, pH, TBARS, PPC e força de cisalhamento foram realizadas a cada sete dias e as microbiológicas duas vezes por semana. Diferentes concentrações de oxigênio dentro da embalagem trouxeram diferença significativa na intensidade de cor vermelha das carnes armazenadas em ATM. Até o sétimo dia de estocagem tratamentos com maior quantidade de O2 apresentaram melhor coloração, após esse período embalagens a vácuo conseguiram preservar melhor a mioglobina. Diferentes concentrações gasosas não trouxeram causaram diferença (p> 0,05) no pH da carne entre tratamentos. Nenhuma diferença significativa entre tratamentos foi encontrada para amostras embaladas em ATM nos parâmetros perda de peso por cocção e força de cisalhamento. A embalagem em atmosfera modificada foi capaz de retardar o crescimento da microbiota presente na carne. Isso levou á preservação da amostra por até 18 dias sob refrigeração, enquanto amostras a vácuo tiveram uma vida útil de 11 dias. Para o estudo do efeito da alta pressão em carne marinada com baixo teor de sódio, as carnes foram inoculadas com 106 UFC/g de carne com E. faecium e Listeria innocua e em seguida marinadas durante 18 horas, a 4°C, em diferentes soluções: 1% NaCl + 1% ácido cítrico, 1% NaCl + 2% ácido cítrico, 2% NaCl + 2% ácido cítrico e 2% NaCl + 2% ácido cítrico. Após a marinação as amostras foram submetidas ao tratamento nas seguintes pressões: Zero (controle), 300MPa, 450Mpa, 600MPa. As análises físico-químicas e microbiológicas foram realizadas logo após o tratamento. O tratamento em alta pressão foi capaz de reduzir a população microbiana em até seis ciclos logarítmicos quando 600Mpa foram aplicados em todas as soluções estudadas. A não aplicação de alta pressão proporcionou a redução de apenas um ciclo log na população de E. faecium quando as carnes foram marinadas com 2% NaCl + 2% ácido cítrico. A alta pressão e as diferentes concentrações de sal e ácido, não trouxeram diferença significativa na coloração das amostras. Já o maior teor de ácido cítrico na marinada causou maior (p<0,05) redução do pH da carne em comparação com as amostras em baixa concentração de ácido. Os experimentos demonstraram que a tanto embalagem a vácuo quanto a aplicação de ácido cítrico foram eficientes em retardar a oxidação lipídica. Pressões de 600Mpa tornaram a carne significativamente mais dura que as demais pressões aplicadas. Os resultados demonstraram a possibilidade de extensão da vida útil da carne refrigerada através da aplicação de diferentes tecnologias: a embalagem com atmosfera modificada para carne fresca e processamento em alta pressão de carnes marinadas com reduzido teor de sal.

Adsorbent density impact on gas storage capacities

In the literature, different approaches, terminologies, concepts and equations are used for calculating gas storage capacities. Very often, these approaches are not well defined, used and/or determined, giving rise to significant misconceptions. Even more, some of these approaches, very much associated with the type of adsorbent material used (e.g., porous carbons or new materials such as COFs and MOFs), impede a suitable comparison of their performances for gas storage applications. We review and present the set of equations used to assess the total storage capacity for which, contrarily to the absolute adsorption assessment, all its experimental variables can be determined experimentally without assumptions, ensuring the comparison of different porous storage materials for practical application. These material-based total storage capacities are calculated by taking into account the excess adsorption, the bulk density (ρbulk) and the true density (ρtrue) of the adsorbent. The impact of the material densities on the results are investigated for an exemplary hydrogen isotherm obtained at room temperature and up to 20 MPa. It turns out that the total storage capacity on a volumetric basis, which increases with both, ρbulk and ρtrue, is the most appropriate tool for comparing the performance of storage materials. However, the use of the total storage capacities on a gravimetric basis cannot be recommended, because low material bulk densities could lead to unrealistically high gravimetric values.

Simultaneous synthesis of work exchange networks with heat integration

The optimal integration of work and its interaction with heat can represent large energy savings in industrial plants. This paper introduces a new optimization model for the simultaneous synthesis of work exchange networks (WENs), with heat integration for the optimal pressure recovery of process gaseous streams. The proposed approach for the WEN synthesis is analogous to the well-known problem of synthesis of heat exchanger networks (HENs). Thus, there is work exchange between high-pressure (HP) and low-pressure (LP) streams, achieved by pressure manipulation equipment running on common axes. The model allows the use of several units of single-shaft-turbine-compressor (SSTC), as well as stand-alone compressors, turbines and valves. Helper motors and generators are used to respond to any demand and excess of energy. Moreover, between the WEN stages the streams are sent to the HEN to promote thermal recovery, aiming to enhance the work integration. A multi-stage superstructure is proposed to represent the process. The WEN superstructure is optimized in a mixed-integer nonlinear programming (MINLP) formulation and solved with the GAMS software, with the goal of minimizing the total annualized cost. Three examples are conducted to verify the accuracy of the proposed method. In all case studies, the heat integration between WEN stages is essential to improve the pressure recovery, and to reduce the total costs involved in the process.

Tailoring the porosity of chemically activated hydrothermal carbons: Influence of the precursor and hydrothermal carbonization temperature

Advanced porous materials with tailored porosity (extremely high development of microporosity together with a narrow micropore size distribution (MPSD)) are required in energy and environmental related applications. Lignocellulosic biomass derived HTC carbons are good precursors for the synthesis of activated carbons (ACs) via KOH chemical activation. However, more research is needed in order to tailor the microporosity for those specific applications. In the present work, the influence of the precursor and HTC temperature on the porous properties of the resulting ACs is analyzed, remarking that, regardless of the precursor, highly microporous ACs could be generated. The HTC temperature was found to be an extremely influential parameter affecting the porosity development and the MPSD of the ACs. Tuning of the MPSD of the ACs was achieved by modification of the HTC temperature. Promising preliminary results in gas storage (i.e. CO2 capture and high pressure CH4 storage) were obtained with these materials, showing the effectiveness of this synthesis strategy in converting a low value lignocellulosic biomass into a functional carbon material with high performance in gas storage applications.

Biodiesel production by transesterification of sludge in supercritical conditions

In this study wastewater treatment plant (WWTP) sludge was subjected to a reactive pyrolysis treatment to produce a high quality pyro-oil. Sludge was treated in supercritical conditions in the presence of methanol using hexane as cosolvent in a high pressure lab-autoclave. The variables affecting the pyro-oil yield and the product quality, such as mass ratio of alcohol to sludge, presence of cosolvent and temperature, were investigated. It was found that the use of a non-polar cosolvent (hexane) presents advantages in the production of high quality pyro-oil from sludge: increase of the non-polar pyro-oil yield and a considerable reduction of the amount of methanol needed to carry out the transesterification of fatty acids present in the sludge.