928 resultados para CALCULATED LEVELS, J, PI USING SHELL MODEL


Relevância:

100.00% 100.00%

Publicador:

Resumo:

Wind power can play an interesting role in irrigation projects in different areas. A methodology can determine the feasibility of the technology and the levels of daily irrigation demand satisfied by windmills at different levels of risk, using tomato (Lycopersicon esculentum Mill) as greenhouse crop. The present work compared the feasibility of the technology and the critical factors involved in three different countries: Cuba, Spain and Pakistan. The study considered as factors the wind speed level, the energy cost, the tomato prices, the reliability and distance to the electrical grid, and the crop development dates, determining the economic feasibility for each combination of factors in each country.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

En la presente Tesis Doctoral se propone una posible solución al problema de la radiación electromagnética. Este es un problema científico estudiado desde hace mucho tiempo y que hasta el presente no se ha podido resolver de manera exacta. Aquí se redefine nuevamente el problema y se plantea el mismo partiendo un modelo de radiador formado por dos placas planas circulares paralelas, que por sus reducidas dimensiones eléctricas, se considerará para el estudio como un dipolo simétrico corto. Se obtienen las soluciones de las ecuaciones de Maxwell para la radiación electromagnética emitida por dicho sistema y se propone lo que sería el principio de formación de las ondas electromagnéticas. Con ayuda de este se ofrece una posible interpretación de las soluciones obtenidas. Luego a dicho sistema se le realizan correcciones en sus dimensiones a fin de ajustar las soluciones obtenidas al caso real de un dipolo simétrico de media onda. Además se analiza de una manera sencilla la naturaleza material del campo electromagnético y su estructura, lo que hace posible proponer una manera original de comprender las ecuaciones de Maxwell. Finalmente se propone un modelo sencillo mediante el cual se puede demostrar la Ley de Planck para la distribución espectral de la energía electromagnética radiada por los cuerpos calientes, pero desde las soluciones de las ecuaciones de Maxwell para la radiación de las antenas. Con esto podría ser aceptado que la solución del problema de la radiación electromagnética es única tanto para las antenas como para los cuerpos calientes en la naturaleza. ABSTRACT In this PhD thesis a possible solution to the problem of electromagnetic radiation is proposed. This is a scientific problem which has been studied for a long time and to this day has still not exactly been solved. The problem is redefined here again and it is stated using a model formed by two flat parallel circular plates as the radiator system, which due to its reduced electrical dimensions will be considered for the study as a short symmetrical dipole. The solutions of the Maxwell equations for emitted electromagnetic radiation are obtained by said system, and that which could be the principle formation of electromagnetic waves is proposed. Using this principle, a possible interpretation of the solutions obtained is presented. Then the system will perform corrections in size to adjust the solutions obtained to the real case of a symmetrical half-wave dipole. The material nature of the electromagnetic field and its structure is also analyzed in a simple way, making it possible to present an original way to understand the Maxwell equations. Finally, a simple model which can be used to prove Planck's law of spectral distribution of the electromagnetic energy radiated by hot bodies is proposed, but parting from the solutions of the Maxwell equations for the antennas radiation. With this it could be accepted that the solution to the problem of electromagnetic radiation is unique to both antennas and hot bodies on nature.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

Las leguminosas grano presentan un perfil nutricional de gran interés para alimentación de ganado porcino, debido principalmente a su elevado contenido proteico. Sin embargo, la presencia de factores antinutritivos (FAN), que según el género difieren en calidad y cantidad, condiciona la absorción de la proteína, el nutriente más valorado. El objetivo de esta Tesis Doctoral ha sido el estudio del efecto de los principales FAN de guisante y alberjón sobre el rendimiento productivo, de canal y de piezas nobles, cuando sustituyen a la soja, parcial o totalmente, durante la fase estárter y el periodo de engorde de cerdos grasos. Con este motivo se llevaron a cabo 4 ensayos con machos castrados y la misma línea genética: híbrido Duroc x (Landrace x Large white). En el ensayo 1, se estudió la influencia de distintos niveles de inhibidores de proteasas (IP) en el pienso sobre la productividad de lechones durante la fase estárter (40 a 61 días de edad). Para ello, se utilizaron tres variedades de guisantes de invierno que contenían diferentes cantidades de IP, tanto de tripsina (IT) como de quimotripsina (IQ) [unidades de tripsina inhibida/mg (UTI), unidades de quimotripsina inhibida/mg (UQI): 9,87- 10,16, 5,75-8,62 y 12,55-15,75, para guisantes Cartouche, Iceberg y Luna, respectivamente] más elevadas que en la harina de soja 47 (HnaS) y en la soja extrusionada (SE) (UTI/mg - UQI/mg: 0,61-3,56 y 2,36-4,65, para HnaS y SE, respectivamente). El diseño experimental fue al azar, con cuatro tratamientos dietéticos que diferían en las fuentes proteicas y en la cantidad de IP, enfrentando un pienso control de soja a otros tres piensos con guisantes de invierno de las variedades indicadas, que sustituían parcialmente a la soja. Cada tratamiento se replicó cuatro veces, siendo la celda con 6 lechones la unidad experimental. Los animales que consumieron el pienso con guisante Cartouche tuvieron más ganancia media diaria (GMD) que el resto (P < 0,001) con el mismo consumo medio diario (CMD) e índice de conversión (IC). No hubo diferencias significativas entre los animales del pienso control y los que consumieron piensos con guisantes Iceberg y Luna. En el ensayo 2 la leguminosa objeto de estudio fue el alberjón y su FAN el dipéptido _Glutamyl-S-Ethenyl-Cysteine (GEC). El diseño y el periodo experimental fueron los mismos que en el ensayo 1, con cuatro dietas que variaban en el porcentaje de alberjones: 0%, 5%, 15% y 25%, y de GEC (1,54% del grano). Los lechones que consumieron el pienso con 5% tuvieron un CMD y GMD más elevado (P < 0,001), con el mismo IC que los animales pertenecientes al tratamiento 0%. Los índices productivos empeoraron significativamente y de manera progresiva al aumentar el porcentaje de alberjones (15 y 25%). Se obtuvieron ecuaciones de regresión con estructura polinomial que fueron significativas tanto para el nivel de alberjón como para la cantidad de GEC presente en el pienso. El ensayo 3 se efectuó durante el periodo de engorde, sustituyendo por completo la soja a partir de los 84 días de edad con las tres variedades de guisantes de invierno, observando el efecto sobre el rendimiento productivo, de canal y piezas nobles. El diseño, en bloques completos al azar, tuvo cuatro tratamientos según el guisante presente en el pienso y, por lo tanto, los niveles de IP: Control-soja, Cartouche, Iceberg y Luna, con 12 réplicas de 4 cerdos por tratamiento. De 84 a 108 días de edad los animales que consumieron los piensos Control-soja e Iceberg, tuvieron el mismo CMD y GMD, empeorando en los cerdos alimentados con Luna y Cartouche (P < 0,05). El IC fue igual en los tratamientos Control-soja e Iceberg, ocupando una posición intermedia en Cartouche y peor en los cerdos del pienso Luna (P < 0,001). De 109 a 127 días de edad la GMD y el IC fueron iguales, con un CMD más elevado en Control-soja e Iceberg que en los cerdos que consumieron Cartouche y Luna (P < 0,05). No hubo diferencias significativas durante el acabado (128 a 167 días de edad). Globalmente el CMD y GMD fueron más elevados en los cerdos que comieron los piensos Iceberg y Control-soja, empeorando por igual en los que comieron Cartouche y Luna (P < 0,05); el IC fue el mismo en todos los tratamientos. No se observaron diferencias en los datos relacionados con peso y rendimiento de canal y piezas nobles (jamón, paleta y chuletero), ni del contenido de grasa intramuscular en el lomo y proporción de ácidos grasos principales (C16:0, C18:0, C18:1n-9) en la grasa subcutánea. En el ensayo 4, realizado durante el periodo de engorde (60 a 171 días de edad), se valoró el efecto de dietas con distintos niveles de alberjones, y en consecuencia de su factor antinutritivo el dipéptido GEC, sobre el rendimiento productivo y la calidad de la canal y piezas nobles. El diseño fue en cuatro bloques completos al azar, con cuatro tratamientos según el porcentaje de inclusión de alberjón en el pienso: 0%, 5%, 15% y 25%, con 12 réplicas por tratamiento y cuatro cerdos en cada una de ellas. El tratamiento con 5% mejoró la GMD al final de la fase de cebo (152 días de vida) y, junto con el 0%, presentaron los resultados más favorables de peso e IC al final del ensayo (171 días de vida). Del mismo modo, el peso y rendimiento de canal fueron más elevados en los cerdos alimentados con los tratamientos 0% y 5% (P < 0,001). Piensos con el 15 y 25% de alberjones empeoraron los resultados productivos, así como el rendimiento y peso de canal. Sucedió lo mismo con el peso de las piezas nobles (jamón, paleta y chuletero), significativamente superior en 0% y 5% frente a 15% y 25%, siendo los cerdos que consumieron este último pienso los peores. Por el contrario el rendimiento de jamón y chuletero fue más elevado en los cerdos de los tratamientos 25% y 15% que en los que consumieron los piensos con 5% y 0% (P < 0,001); en el rendimiento de paletas se invirtieron los resultados, siendo mayores en los animales de los tratamientos 0% y 5% (P < 0,001). Se obtuvieron ecuaciones de regresión polinomial, para estimar las cantidades de inclusión de alberjones y de GEC más favorables desde el punto de vista productivo, así como los contrastes ortogonales entre los distintos tratamientos. ABSTRACT The grain legumes have a nutritional profile of great interest to feed pigs, mainly due to high protein content. However, the presence of antinutritional factors (ANF), which differ in quality and quantity according to gender, hinder the absorption of the protein, the most valuable nutrient. The aim of this thesis was to study the effect of the main ANF of pea and narbon vetch (NV) on productive performance, of the carcass and main lean cuts, when replacing soybean, partially or totally, during the starter phase and the fattening period of heavy pigs. For this reason were carried four trials with barrows and the same genetic line: Duroc hybrid x (Landrace x Large white). In trial 1, was studied the influence of different levels of protease inhibitors (PI) in the diet over productivity of piglets during the starter phase (40-61 days of age). For this, were used three varieties of winter peas containing different amounts of PI, both trypsin (TI) and chymotrypsin (CI) [inhibited units/mg trypsin (TIU), inhibited units/mg chymotrypsin (CIU): 9.87 - 10.16, 5.75 - 8.62 and 12.55 - 15.75, for peas Cartouche, Iceberg and Luna, respectively] higher than in soybean meal 47 (SBM) and soybeans extruded (SBE) (TIU/mg - CIU/mg: 0.61 - 3.56 and 2.36 - 4.65 for SBM and SBE, respectively). The design was randomized with four dietary treatments differing in protein sources and the amount of PI, with a control diet of soybean and three with different varieties of winter peas: Cartouche, Iceberg and Luna, which partially replace soybean. Each treatment was replicated four times, being the pen with 6 piglets the experimental unit. Pigs that ate the feed with pea Cartouche had better growth (ADG) than the rest (P < 0.001), with the same average daily feed intake (ADFI) and feed conversion ratio (FCR). There were no significant differences between piglets fed with control diet and those fed Iceberg and Luna diets. In trial 2 the legume under study was the NV and your ANF the dipeptide _Glutamyl FAN-S-Ethenyl-Cysteine (GEC). The experimental period and the design were the same as in trial 1, with four diets with different percentage of NV: 0%, 5%, 15% and 25%, and from GEC (1.52% of the grain). The piglets that consumed the feed containing 5% had higher ADG and ADFI (P < 0.05), with the same FCR that pigs belonging to the 0% treatment. Production rates worsened progressively with increasing percentage of NV (15 and 25%). Were obtained regression equations with polynomial structure that were significant for NV percentage and amount of GEC present in the feed. The test 3 was carried out during the fattening period, completely replace soy from 84 days of age with three varieties of winter peas, observing the effect on the yield, carcass and main lean cuts. The design, randomized complete blocks, had four treatments with different levels of PI: Control-soy, Cartouche, Iceberg and Luna, with 12 replicates of 4 pigs per treatment. From 84 to 108 days of age the pigs fed with Control-soy and Iceberg feed, had the same ADFI and ADG, worsening in pigs fed with Luna and Cartouche (P < 0.05). The FCR was similar in diets Control-soy and Iceberg, occupying an intermediate position in Cartouche and worse in pigs fed with Luna (P < 0.001). From 109-127 days of age the ADG and FCR were equal, with higher ADFI in pigs fed with Control-soy and Iceberg, regarding pigs fed with Cartouche and Luna (P < 0.05). There was no difference in the finishing phase (128-167 days of age). In global period, the ADFI and ADG were higher in pigs that ate Control-soy and Iceberg, and worse in those who ate Cartouche and Luna. The FCR was the same in all treatments. No significant differences were observed in the data related to weight and carcass yield, main lean cuts (ham, shoulder and loin chop) and intramuscular fat loin content and major fatty acids proportion (C16:0, C18:0, C18:1n-9) of subcutaneous fat. In experiment 4, made during the fattening period (60-171 days of age), was assessed the effect of diets with different levels of NV, and consequently of GEC, in the performance and quality of carcass and main lean cuts. There was a completely randomized design with four dietary treatments differing in percentage of NV: 0%, 5%, 15% and 25%, with 12 replicates per treatment and four pigs each. Treatment with 5% improved the ADG at the end of the fattening phase (152 days of age) and, together with 0%, showed the most favorable body weight and FCR at the end of the trial (171 days of age). Similarly, the weight and performance of carcass were higher for pigs fed with diets 0% and 5% (P < 0.05). Diets with 15 and 25% worsened the productive and carcass results. The weight of the main lean cuts (ham, shoulder and loin chop) was significantly higher in 0% and 5% vs 15% and 25%.The diet 25% was the worst of all. By contrast the performance of ham and loin chop was higher in pigs fed with diets 25% and 15%, that those who ate diets with 5% and 0% (P < 0.001); the results of shoulder performance were reversed, being greater in pigs feed with diets 0% and 5% (P < 0.001). Polynomial regression equations were obtained to estimate the percentage of NV and GEC more favorable from the point of view of production, and orthogonal contrasts between treatments.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

The electronic nature of low-barrier hydrogen bonds (LBHBs) in enzymatic reactions is discussed based on combined low temperature neutron and x-ray diffraction experiments and on high level ab initio calculations by using the model substrate benzoylacetone. This molecule has a LBHB, as the intramolecular hydrogen bond is described by a double-well potential with a small barrier for hydrogen transfer. From an “atoms in molecules” analysis of the electron density, it is found that the hydrogen atom is stabilized by covalent bonds to both oxygens. Large atomic partial charges on the hydrogen-bonded atoms are found experimentally and theoretically. Therefore, the hydrogen bond gains stabilization from both covalency and from the normal electrostatic interactions found for long, weak hydrogen bonds. Based on comparisons with other systems having short-strong hydrogen bonds or LBHBs, it is proposed that all short-strong and LBHB systems possess similar electronic features of the hydrogen-bonded region, namely polar covalent bonds between the hydrogen atom and both heteroatoms in question.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

The electronic excitations of naphthalene and a family of bridged naphthalene dimers are calculated and analyzed by using the Collective Electronic Oscillator method combined with the oblique Lanczos algorithm. All experimentally observed trends in absorption profiles and radiative lifetimes are reproduced. Each electronic excitation is linked to the corresponding real-space transition density matrix, which represents the motions of electrons and holes created in the molecule by photon absorption. Two-dimensional plots of these matrices help visualize the degree of exciton localization and explain the dependence of the electronic interaction between chromophores on their separation.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

Epitopes depending on three-dimensional folding of proteins have during recent years been acknowledged to be main targets for many autoantibodies. However, a detailed resolution of conformation-dependent epitopes has to date not been achieved in spite of its importance for understanding the complex interaction between an autoantigen and the immune system. In analysis of immunodominant epitopes of the U1-70K protein, the major autoantigen recognized by human ribonucleoprotein (RNP)-positive sera, we have used diversely mutated recombinant Drosophila melanogaster 70K proteins as antigens in assays for human anti-RNP antibodies. Thus, the contribution of individual amino acids to antigenicity could be assayed with the overall structure of the major antigenic domain preserved, and analysis of how antigenicity can be reconstituted rather than obliterated was enabled. Our results reveal that amino acid residue 125 is situated at a crucial position for recognition by human anti-RNP autoantibodies and that flanking residues at positions 119–126 also appear to be of utmost importance for recognition. These results are discussed in relation to structural models of RNA-binding domains, and tertiary structure modeling indicates that the residues 119–126 are situated at easily accessible positions in the end of an α-helix in the RNA binding region. This study identifies a major conformation-dependent epitope of the U1-70K protein and demonstrates the significance of individual amino acids in conformational epitopes. Using this model, we believe it will be possible to analyze other immunodominant regions in which protein conformation has a strong impact.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

Cancer relapse after surgery is a common occurrence, most frequently resulting from the outgrowth of minimal residual disease in the form of metastases. We examined the effectiveness of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) blockade as an adjunctive immunotherapy to reduce metastatic relapse after primary prostate tumor resection. For these studies, we developed a murine model in which overt metastatic outgrowth of TRAMP-C2 (C2) prostate cancer ensues after complete primary tumor resection. Metastatic relapse in this model occurs reliably and principally within the draining lymph nodes in close proximity to the primary tumor, arising from established metastases present at the time of surgery. Using this model, we demonstrate that adjunctive CTLA-4 blockade administered immediately after primary tumor resection reduces metastatic relapse from 97.4 to 44%. Consistent with this, lymph nodes obtained 2 weeks after treatment reveal marked destruction or complete elimination of C2 metastases in 60% of mice receiving adjunctive anti-CTLA-4 whereas 100% of control antibody-treated mice demonstrate progressive C2 lymph node replacement. Our study demonstrates the potential of adjunctive CTLA-4 blockade immunotherapy to reduce cancer relapse emanating from minimal residual metastatic disease and may have broader implications for improving the capability of immunotherapy by combining such forms of therapy with other cytoreductive measures including surgery.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

Drug treatment of HIV type 1 (HIV-1) infection leads to a rapid initial decay of plasma virus followed by a slower second phase of decay. To investigate the role of HIV-1 retained on follicular dendritic cells (FDCs) in this process, we have developed and analyzed a mathematical model for HIV-1 dynamics in lymphoid tissue (LT) that includes FDCs. Analysis of clinical data using this model indicates that decay of HIV-1 during therapy may be influenced by release of FDC-associated virus. The biphasic character of viral decay can be explained by reversible multivalent binding of HIV-1 to receptors on FDCs, indicating that the second phase of decay is not necessarily caused by long-lived or latently infected cells. Furthermore, viral clearance and death of short-lived productively infected cells may be faster than previously estimated. The model, with reasonable parameter values, is consistent with kinetic measurements of viral RNA in plasma, viral RNA on FDCs, productively infected cells in LT, and CD4+ T cells in LT during therapy.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

The potential for health risks to humans exposed to the asbestos minerals continues to be a public health concern. Although the production and use of the commercial amphibole asbestos minerals—grunerite (amosite) and riebeckite (crocidolite)—have been almost completely eliminated from world commerce, special opportunities for potentially significant exposures remain. Commercially viable deposits of grunerite asbestos are very rare, but it can occur as a gangue mineral in a limited part of a mine otherwise thought asbestos-free. This report describes such a situation, in which a very localized seam of grunerite asbestos was identified in an iron ore mine. The geological occurrence of the seam in the ore body is described, as well as the mineralogical character of the grunerite asbestos. The most relevant epidemiological studies of workers exposed to grunerite asbestos are used to gauge the hazards associated with the inhalation of this fibrous mineral. Both analytical transmission electron microscopy and phase-contrast optical microscopy were used to quantify the fibers present in the air during mining in the area with outcroppings of grunerite asbestos. Analytical transmission electron microscopy and continuous-scan x-ray diffraction were used to determine the type of asbestos fiber present. Knowing the level of the miner’s exposures, we carried out a risk assessment by using a model developed for the Environmental Protection Agency.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

Wollastonia biflora (L.) DC. plants accumulate the osmoprotectant 3-dimethylsulfoniopropionate (DMSP), particularly when salinized. DMSP is known to be synthesized in the chloroplast from S-methylmethionine (SMM) imported from the cytosol, but the sizes of the chloroplastic and extrachloroplastic pools of these compounds are unknown. We therefore determined DMSP and SMM in mesophyll protoplasts and chloroplasts. Salinization with 30% (v/v) artificial seawater increased protoplast DMSP levels from 4.6 to 6.0 μmol mg−1 chlorophyll (Chl), and chloroplast levels from 0.9 to 1.9 μmol mg−1 Chl. The latter are minimum values because intact chloroplasts leaked DMSP during isolation. Correcting for this leakage, it was estimated that in vivo about one-half of the DMSP is chloroplastic and that stromal DMSP concentrations in control and salinized plants are about 60 and 130 mm, respectively. Such concentrations would contribute significantly to chloroplast osmoregulation and could protect photosynthetic processes from stress injury. SMM levels were measured using a novel mass-spectrometric method. About 40% of the SMM was located in the chloroplast in unsalinized W. biflora plants, as was about 80% in salinized plants; the chloroplastic pool in both cases was approximately 0.1 μmol mg−1 Chl. In contrast, ≥85% of the SMM was extrachloroplastic in pea (Pisum sativum L.) and spinach (Spinacia oleracea L.), which lack DMSP. DMSP synthesis may be associated with enhanced accumulation of SMM in the chloroplast.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

In many diseases, tissue hypoxia occurs in conjunction with other inflammatory processes. Since previous studies have demonstrated a role for leukocytes in ischemia/reperfusion injury, we hypothesized that endothelial hypoxia may "superinduce" expression of an important leukocyte adhesion molecule, E-selectin (ELAM-1, CD62E). Bovine aortic endothelial monolayers were exposed to hypoxia in the presence or absence of tumor-necrosis factor alpha (TNF-alpha) or lipopolysaccharide (LPS). Cell surface E-selectin was quantitated by whole cell ELISA or by immunoprecipitation using polyclonal anti-E-selectin sera. Endothelial mRNA levels were assessed using ribonuclease protection assays. Hypoxia alone did not induce endothelial E-selectin expression. However, enhanced induction of E-selectin was observed with the combination of hypoxia and TNF-alpha (270% increase over normoxia and TNF-alpha) or hypoxia and LPS (190% increase over normoxia and LPS). These studies revealed that a mechanism for such enhancement may be hypoxia-elicited decrements in endothelial intracellular levels of cAMP (<50% compared with normoxia). Addition of forskolin and isobutyl-methyl-xanthine during hypoxia resulted in reversal of cAMP decreases and a loss of enhanced E-selectin surface expression with the combination of TNF-alpha and hypoxia. We conclude that endothelial hypoxia may provide a novel signal for superinduction of E-selectin during states of inflammation.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

Cholecystokinin (CCK) secretion in rats and humans is inhibited by pancreatic proteases and bile acids in the intestine. It has been hypothesized that the inhibition of CCK release caused by pancreatic proteases is due to proteolytic inactivation of a CCK-releasing peptide present in intestinal secretion. To purify the putative luminal CCK-releasing factor (LCRF), intestinal secretions were collected by perfusing a modified Thiry-Vella fistula of jejunum in conscious rats. From these secretions, the peptide was concentrated by ultrafiltration followed by low-pressure reverse-phase chromatography and purified by reverse-phase high-pressure liquid chromatography. Purity was confirmed by high-performance capillary electrophoresis. Fractions were assayed for CCK-releasing activity by their ability to stimulate pancreatic protein secretion when infused into the proximal small intestine of conscious rats. Partially purified fractions strongly stimulated both pancreatic secretion and CCK release while CCK receptor blockade abolished the pancreatic response. Amino acid analysis and mass spectral analysis showed that the purified peptide is composed of 70-75 amino acid residues and has a mass of 8136 Da. Microsequence analysis of LCRF yielded an amino acid sequence for 41 residues as follows: STFWAYQPDGDNDPTDYQKYEHTSSPSQLLAPGDYPCVIEV. When infused intraduodenally, the purified peptide stimulated pancreatic protein and fluid secretion in a dose-related manner in conscious rats and significantly elevated plasma CCK levels. Immunoaffinity chromatography using antisera raised to synthetic LCRF-(1-6) abolished the CCK releasing activity of intestinal secretions. These studies demonstrate, to our knowledge, the first chemical characterization of a luminally secreted enteric peptide functioning as an intraluminal regulator of intestinal hormone release.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

Ionotropic glutamate receptors, neurotransmitter-activated ion channels that mediate excitatory synaptic transmission in the central nervous system, are oligomeric membrane proteins of unknown subunit stoichiometry. To determine the subunit stoichiometry we have used a functional assay based on the blockade of two alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate/kainate receptor subunit 1 (GluR1) mutant subunits selectively engineered to exhibit differential sensitivity to the open channel blockers phencyclidine and dizolcipine (MK-801). Coinjection into amphibian oocytes of weakly sensitive with highly sensitive subunit complementary RNAs produces functional heteromeric channels with mixed blocker sensitivities. Increasing the fraction of the highly sensitive subunit augmented the proportion of drug-sensitive receptors. Analysis of the data using a model based on random aggregation of receptor subunits allowed us to determine a pentameric stoichiometry for GluR1. This finding supports the view that a pentameric subunit organization underlies the structure of the neuronal ionotropic glutamate receptor gene family.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

The hypothalamic hormone gonadotropin-releasing hormone (GnRH) is released in a pulsatile fashion, with its frequency varying throughout the reproductive cycle. Varying pulse frequencies and amplitudes differentially regulate the biosynthesis and secretion of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) by pituitary gonadotropes. The mechanism by which this occurs remains a major question in reproductive physiology. Previous studies have been limited by lack of available cell lines that express the LH and FSH subunit genes and respond to GnRH. We have overcome this limitation by transfecting the rat pituitary GH3 cell line with rat GnRH receptor (GnRHR) cDNA driven by a heterologous promoter. These cells, when cotransfected with regulatory regions of the common alpha, LH beta, or FSH beta subunit gene fused to a luciferase reporter gene, respond to GnRH with an increase in luciferase activity. Using this model, we demonstrate that different cell surface densities of the GnRHR result in the differential regulation of LH and FSH subunit gene expression by GnRH. This suggests that the differential regulation of gonadotropin subunit gene expression by GnRH observed in vivo in rats may, in turn, be mediated by varying gonadotrope cell surface GnRHR concentrations. This provides a physiologic mechanism by which a single ligand can act through a single receptor to regulate differentially the production of two hormones in the same cell.

Relevância:

100.00% 100.00%

Publicador:

Resumo:

Tolerance induction by thymic epithelium induces a state of so-called "split tolerance," characterized in vivo by tolerance and in vitro by reactivity to a given thymically expressed antigen. Using a model major histocompatibility complex class I antigen, H-2Kb (Kb), three mechanisms of thymic epithelium-induced tolerance were tested: induction of tolerance of tissue-specific antigens exclusively, selective inactivation of T helper cell-independent cytotoxic T lymphocytes, and deletion of high-avidity T cells. To this end, thymic anlagen from Kb-transgenic embryonic day 10 mouse embryos, taken before colonization by cells of hemopoietic origin, were grafted to nude mice. Tolerance by thymic epithelium was not tissue-specific, since Kb-bearing skin and spleen grafts were maintained indefinitely. Only strong priming in vivo could partially overcome the tolerant state and induce rejection of some skin grafts overexpressing transgenic Kb. Furthermore, the hypothesis that thymic epithelium selectively inactivates those T cells that reject skin grafts in a T helper-independent fashion could not be supported. Thus, when T-cell help was provided by a second skin graft bearing an additional major histocompatibility complex class II disparity, tolerance to the Kb skin graft was not broken. Finally, direct evidence could be obtained for the avidity model of thymic epithelium-induced negative selection, using Kb-specific T-cell receptor (TCR) transgenic mice. Thymic epithelium-grafted TCR transgenic mice showed a selective deletion of those CD8+ T cells with the highest density of the clonotypic TCR. These cells presumably represent the T cells with the highest avidity for Kb. We conclude that split tolerance induced by thymic epithelium was mediated by the deletion of those CD8+ T lymphocytes that have the highest avidity for antigen.