953 resultados para Neotropical fauna
Resumo:
[ES] Erbanense es el nombre de los depósitos marinos canarios posteriores a la glaciación última europea y proviene de Erbania antiguo nombre de Fuerteventura. En La Jaqueta, al sur de la isla, aparecen los restos pedregosos de dos pulsaciones del mar. La última de ellas ocurrió hacia el año 600 de nuestra era según dataciones radiocarbónicas. La isla por entonces ya estaba habitada por sus primeros pobladores de probable origen paleobereber y hay un antiguo poblado en las proximidades de la playa. El antiguo cordón litoral está cuatro metros más alto que el nivel medio del mar actual y en él se han colectado más de dos mil conchas que muestran que la fauna marina era semejante a la que vive actualmente en el litoral canario.
Resumo:
[ES] Más de mil fósiles marinos colectados en el antiguo cordón litoral en la localidad de Las Playitas muestran que una cuarta parte de las conchas pertenecen a caracolas que no viven en la actualidad en las Islas Canarias y sin embargo viven en las costas atlánticas de África ecuatorial, en el Golfo de Guinea. Ello es prueba de la existencia de un cambio climático durante el cual desapareció el invierno en las latitudes de Canarias y del Mediterráneo y se fundieron los hielos polares causando una elevación del nivel de la mar próxima a los cinco metros de altura. Todo ello a causa de la trayectoria astronómica de la Tierra.
Resumo:
[ES]¿Qué hay en las aguas profundas de El Hierro? La organización de conservación marina Oceana presenta los hallazgos efectuados en el Mar de las Calmas con un robot submarino (ROV) capaz de descender a 1.000 metros. Estas imágenes revelan desde fondos de anguilas jardineras a arrecifes vivos de corales blancos de profundidad, de la freza del tamboril oceánico a rocas cubiertas de ostras gigantes. Durante la presentación se mostrarán hallazgos de interés mundial, como el primer vídeo obtenido de un pez transparente de seis ojos. Se describirán las profundidades al sur de la isla, explicando sus necesidades de protección, y se enseñarán imágenes de tiburones de aguas profundas, peces trípode, crinoideos, esponjas carnívoras y erizos de cuero, entre otras.
Resumo:
È ormai noto che numerosi organismi marini, dalle alghe unicellulari ai pesci coabitino con diverse specie di spugne, con un rapporto che varia, secondo i casi, dal semplice inquilinismo facoltativo alle più complesse simbiosi obbligate. All’interno di molte spugne si trovano degli endobionti, alcuni organismi rappresentano degli ospiti puramente occasionali, altri manifestano una notevole costanza e l’esistenza in associazione alla spugna sembra rappresenti la norma. In Adriatico settentrionale, nell’area compresa tra Grado ed il delta del fiume Po, sono presenti degli affioramenti rocciosi organogeni carbonatici che prendono il nome di tegnùe. In questi affioramenti è stata riscontrata una grande varietà di specie macrobentoniche sia sessili che vagili. Tra queste specie, è presente con elevate abbondanze e grandi dimensioni, fuori dal comune, la spugna massiva Geodia cydonium, oggetto del nostro studio. Lo scopo del presente lavoro è di caratterizzare la diversità della fauna associata alla demospongia Geodia cydonium, cercando di mettere in evidenza l’importante ruolo ecologico legato proprio all’elevato numero di inquilini che ospita. Sono stati prelevati campioni di spugna, con la relativa fauna associata, da tre siti presenti all’interno della Zona di Tutela Biologica di Chioggia. Date le grandi dimensioni degli esemplari e per non danneggiare la popolazione naturale di questa rara specie protetta, sono stati prelevati in immersione delle porzioni di spugna, incidendo verticalmente gli esemplari. Nei campioni sono stati riscontrati 28 taxa, tra cui prevalgono per abbondanza i policheti come Ceratonereis costae e Sphaerosyllis bulbosa e piccoli crostacei come Apseudopsis acutifrons e Leptochelia savignyi. Per molte specie prevalgono individui giovanili rispetto agli adulti. L’abbondanza e la ricchezza dei popolamenti associati alla spugna non risultano variare ne tra i siti di campionamento ne in relazione alle dimensioni degli esemplari da cui provengono i campioni. Questo fa supporre che la spugna crei un ambiente ideale per alcune specie, almeno nelle fasi giovanili, creando così associazioni relativamente stabili, più di quanto non sia la naturale variabilità dei popolamenti circostanti. Queste relazioni meritano di essere approfondite, investigando i cicli vitali e i comportamenti delle singole specie.
Resumo:
Food items and nematode parasites were identified from the stomachs of 42 individuals of Phocoena phocoena, 6 of Lagenorhynchus acutus and 8 of L. albirostris stranded off the coastal waters of Northern Scotland between 2004 and 2014. Post-mortem examinations have revealed heavy parasitic worm burdens. Four nematode species complex as Anisakis spp., Contracaeucum spp., Pseudoterronova spp., and Hysterothylacium spp. were recorded. Data on presence of the anisakid species in cetaceans, reported a significative relationship between the presence of Hysterothylacium and the month of host stranding; suggesting a decrease of larval H. aduncum abundance in the period between April and August due to a seasonal effect related to prey availability. Similarly, the parasite burden of the all anisakid genera was related to the year fraction of stranding, and a relationship statistically significant was found just for L. albirostris with an increase between April and October. This finding is explained by a seasonality in occurrence of white-beaked dolphins, with a peak during August, that might be related to movements of shared prey species and competition with other species (Tursiops truncatus). Geographical differences were observed in parasites number of all anisakid species, which was the highest in cetaceans from the East area and lowest in the North coast. The parasites number also increased significantly with the length of the animal and during the year, but with a significant seasonal pattern only for P. phocoena. Regarding diet composition, through a data set consisting of 34 harbour porpoises and 1 Atlantic white-sided dolphins, we found a positive association between parasite number and the cephalopods genus Alloteuthis. This higher level of parasite infection in squid from this area, is probably due to a quantitative distribution of infective forms in squid prey, an abundance of the final host and age or size maturity of squid.
Resumo:
Polychaetes are one of the larger groups of macroinvertebrates with more than 9000 species recognised, distributed worldwide. Thanks to the broad ecological adaptability and high abundaces, this taxon plays a leading role and is considered an important component of all benthic assemblages. Our knowledge about the West Iberian Coast polychaete fauna are scarce, and the only studies are recent. In this sense, the aim of this work was to investigate the composition and the spatial distribution of the polychaete fauna along the NW Portuguese Coastal Shelf, focusing on their relationship to environmental factors (depth, grain size, longitude and latitude) and to add new data to the existing biological dataset. A total of 39 sites were analysed, collected in an area of about 5665 km², between 20 and 150 m depth, distributed in a way to cover the overall grain size gradient. A total of 9352 specimens belonging to 41 families were found, and the analysis based on the abundance of polychaete species revealed five affinity groups: (a) nearshore medium sand characterised by Pisione parapari and Hesionura elongata; (b) very coarse sand that showed the highest abundance of Syllidae and was characterised by Protodorvillea kefersteini and Syllis garciai; (c) fine sand dominated by Spiophanes bombyx and Glycera tridactyla; (d) very fine sand with Nepthys assimilis and Amage sp. and the highest abundance of Paraonidae; (d) mud characterised by Labioleanira yhleni and Ampharete finmarchica. The combination of the environmental variables and the biological data, done with BIOENV routine, demonstrated that depth, grain size and fine contents were the best related with the biological data (rho=0.598). In general, the results agree with the composition and the spatial distribution of the polychaete fauna in other parts of the world; further polychaete assemblages related to mud sediments were firstly recorded in the Northwestern Portuguese Coastal Shelf.
Resumo:
The cultivation of genetically modified (GM) plants has raised several environmental concerns. One of these concerns regards non-target soil fauna organisms, which play an important role in the decomposition of organic matter and hence are largely exposed to GM plant residues. Soil fauna may be directly affected by transgene products or indirectly by pleiotropic effects such as a modified plant metabolism. Thus, ecosystem services and functioning might be affected negatively. In a litterbag experiment in the field we analysed the decomposition process and the soil fauna community involved. Therefore, we used four experimental GM wheat varieties, two with a race-specific antifungal resistance against powdery mildew (Pm3b) and two with an unspecific antifungal resistance based on the expression of chitinase and glucanase. We compared them with two non-GM isolines and six conventional cereal varieties. To elucidate the mechanisms that cause differences in plant decomposition, structural plant components (i.e. C:N ratio, lignin, cellulose, hemicellulose) were examined and soil properties, temperature and precipitation were monitored. The most frequent taxa extracted from decaying plant material were mites (Cryptostigmata, Gamasina and Uropodina), springtails (Isotomidae), annelids (Enchytraeidae) and Diptera (Cecidomyiidae larvae). Despite a single significant transgenic/month interaction for Cecidomyiidae larvae, which is probably random, we detected no impact of the GM wheat on the soil fauna community. However, soil fauna differences among conventional cereal varieties were more pronounced than between GM and non-GM wheat. While leaf residue decomposition in GM and non-GM wheat was similar, differences among conventional cereals were evident. Furthermore, sampling date and location were found to greatly influence soil fauna community and decomposition processes. The results give no indication of ecologically relevant adverse effects of antifungal GM wheat on the composition and the activity of the soil fauna community.
Resumo:
Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 +/- 0.3 microM. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.
Resumo:
The study of the micro-fauna of Montana formations has been almost entirely neglected. Because the petroleum industry of this state has not felt the necessity for using micro-paleontology in its sub-surface correlations, the science has been but little used. The Montana Power Company has had an examination made of some of its well cuttings by a competent micro-paleontologist who found some foraminifera in Mesozoic sediments. However, no investigations have been made to determine the presence and character of the micro-fauna of the Paleozoic formations of Montana.
Resumo:
The purpose of this paper is to identify and describe the fauna, correlate it with that of the Upper Devonian of other states, to note the geographic distribution, lithologic variations of outcrops, and to compare measured cross sections.