Isolation, characterization and biological activity of acidic phospholipase A(2) isoforms from Bothrops jararacussu snake venom

Acidic phospholipase A(2) (PLA(2)) isoforms in snake venoms, particularly those from Bothrops jararacussu, have not been characterized. This article reports the isolation and partial biochemical, functional and structural characterization of four acidic PLA(2)s (designated SIIISPIIA, SIIISPIIB, SIIISPIIIA and SIIISPIIIB) from this venom. The single chain purified proteins contained 122 amino acid residues and seven disulfide bonds with approximate molecular masses of 15 kDa and isoelectric points of 5.3. The respective N-terminal sequences were: SIIISPIIA-SLWQFGKMIDYVMGEEGAKS; SIIISPIIB-SLWQFGKMIFYTGKNEPVLS; SIIISPIIIA-SLWQFGKMILYVMGGEGVKQ and SIIISPIIIB-SLWQFGKMIFYEMTGEGVL. Crystals of the acidic protein SIIISPIIIB diffracted beyond 1.8 Angstrom resolution. These crystals are monoclinic with unit cell dimensions of a = 40.1 Angstrom, b = 54.2 Angstrom and c = 90.7 Angstrom. The crystal structure has been refined to a crystallographic residual of 16.1% (R-free = 22.9%). Specific catalytic activity (U/mg) of the isolated acidic PLA(2)s were SIIISPIIA = 290.3 U/mg; SIIISPIIB = 279.0 U/mg; SIIISPIIIA = 270.7 U/mg and SIIISPIIIB = 96.5 U/mg. Although their myotoxic activity was low, SIIISPIIA, SIIISPIIIB and SIIISPIIIA showed significant anticoagulant activity. However, there was no indirect hemolytic activity. SIIISPIIIB revealed no anticoagulant, but presented indirect hemolytic activity. With the exception of SIIISPIIIB, which inhibited platelet aggregation, all the others were capable of inducing time-independent edema. Chemical modification with 4-bromophenacyl bromide did not inhibit the induction of edema, but did suppress other activities. (C) 2003 Editions scientifiques et medicales Elsevier SAS. All rights reserved.

Development of a micro-heat exchanger with stacked plates using LTCC technology

A green ceramic tape micro-heat exchanger was developed using Low Temperature Co-fired Ceramics technology (LTCC). The device was designed by using Computational Aided Design software and simulations were made using a Computational Fluid Dynamics package (COMSOL Multiphysics) to evaluate the homogeneity of fluid distribution in the microchannels. Four geometries were proposed and simulated in two and three dimensions to show that geometric details directly affect the distribution of velocity in the micro-heat exchanger channels. The simulation results were quite useful for the design of the microfluidic device. The micro-heat exchanger was then constructed using the LTCC technology and is composed of five thermal exchange plates in cross-flow arrangement and two connecting plates, with all plates stacked to form a device with external dimensions of 26 x 26 x 6 mm(3).

Effects of the planetary migration on some primordial satellites of the outer planets

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Geothermal investigations in an area of induced seismic activity, northern São Paulo State, Brazil

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

A comparative study of digestive cells in different midgut regions of stingless bees (Hymenoptera: Apidae: Meliponinae)

Ultrastructure of the digestive cells was analyzed in three midgut regions (anterior, middle and posterior) of stingless bees. Variations occurs in the presence of lipid inclusions in the cells from posterior midgut and presence of double-membraned vesicles associated to microvilli in the anterior midgut. However, basal plasmic membrane infoldings and augmentation of surface area achieved by microvilli are very similar in all midgut regions. These results not supported the existence of fluid fluxes in the ectoperitrophic space and suggest that digestive cells in stingless bees are polifunctional, that is, there is not midgut region specialized in secretion or absorption as observed in other insects.

Effects of SO(10) D terms on SUSY signals at the Fermilab Tevatron

We study signals for the production of superparticles at the Fermilab Tevatron in supergravity scenarios based on the grand unified group SO(10). The breaking of this group introduces extra contributions to the masses of all scalars, described by a single new parameter. We find that varying this parameter can considerably change the size of various expected signals studied in the literature, with different numbers of jets and/or charged leptons in the final state. The ratios of these signals can thus serve as a diagnostic to detect or constrain deviations from the much-studied scenario where all scalar masses are universal at the GUT scale. Moreover, under favorable circumstances some of these signals, and/or new signals involving hard b jets, should be observable at the next run of the Fermilab Tevatron collider even if the average scalar mass lies well above the gluino mass. ©2000 The American Physical Society.

Lower bound to the mass of a relativistic three-boson system in the lightcone

The lower bound masses of the ground-state relativistic three-boson system in 1 + 1, 2 + 1 and 3 + 1 spacetime dimensions are obtained. We have considered a reduction of the ladder Bethe-Salpeter equation to the lightfront in a model with renormalized two-body contact interaction. The lower bounds are deduced with the constraint of reality of the two-boson subsystem mass. It is verified that, in some cases, the lower bound approaches the ground-state binding energy. The corresponding non-relativistic limits are also verified.

Thermally developing forced convection of non-Newtonian fluids inside elliptical ducts

Laminar-forced convection inside tubes of various cross-section shapes is of interest in the design of a low Reynolds number heat exchanger apparatus. Heat transfer to thermally developing, hydrodynamically developed forced convection inside tubes of simple geometries such as a circular tube, parallel plate, or annular duct has been well studied in the literature and documented in various books, but for elliptical duct there are not much work done. The main assumptions used in this work are a non-Newtonian fluid, laminar flow, constant physical properties, and negligible axial heat diffusion (high Peclet number). Most of the previous research in elliptical ducts deal mainly with aspects of fully developed laminar flow forced convection, such as velocity profile, maximum velocity, pressure drop, and heat transfer quantities. In this work, we examine heat transfer in a hydrodynamically developed, thermally developing laminar forced convection flow of fluid inside an elliptical tube under a second kind of a boundary condition. To solve the thermally developing problem, we use the generalized integral transform technique (GITT), also known as Sturm-Liouville transform. Actually, such an integral transform is a generalization of the finite Fourier transform, where the sine and cosine functions are replaced by more general sets of orthogonal functions. The axes are algebraically transformed from the Cartesian coordinate system to the elliptical coordinate system in order to avoid the irregular shape of the elliptical duct wall. The GITT is then applied to transform and solve the problem and to obtain the once unknown temperature field. Afterward, it is possible to compute and present the quantities of practical interest, such as the bulk fluid temperature, the local Nusselt number, and the average Nusselt number for various cross-section aspect ratios.

The expression of aquaporins 1 and 9 in adult rat epididymis is perturbed by chronic exposure to ethanol

Aquaporins (AQPs), notably AQP-1 and AQP-9, may contribute to reabsorption of fluid and solute across the epididymis. Ethanol is related to be a toxicant affecting directly or indirectly the epididymis and the sperm motility. This study examined the expression of AQP-1 and AQP-9 in adult epididymis of the UChA and UChB 10% (v/v) ethanol-preferring rats, focusing the ethanol-induced hormonal disturbances upon the regulation of these AQPs. Chronic ethanol intake significantly decreased body weight, while UChA and UChB rats displayed a marked loss of epididymal weights. Both ethanol-consuming animals had a severe reduction of testosterone levels, whereas LH and 17β-estradiol were unchanged. Throughout the epididymis, a strong reaction to AQP-1 was observed in myoid and endothelial cells of the UChB ethanol-preferring rats, differently from a moderate intensity in the initial segment of the UChA rats. In addition, AQP-9 showed a strong immunoreaction in the apical membrane of principal cells at initial segment. In cauda epididymis, the level of AQP-9 was reduced along the microvillus projections in both UChA and UChB rats compared to controls. We conclude that chronic ethanol consumption modulates the androgen levels, thereby modifying the expression pattern of AQP-1 and 9 in the epididymis. © 2011 Elsevier Ltd.

Noninvasive aspergillosis as a maxillary antrolith: report of a rare case.

Maxillary antrolithiasis is characterized by masses of tissue of endogenous or exogenous origin that calcify within the maxillary sinuses. Aspergillosis is a fungal disease in which the maxillary sinus is a primary site of infection. Aspergillosis mycetoma, its noninvasive form, is the most prevalent modality of the disease in the maxillary sinuses. In approximately half of the cases reported in the literature, calcification of the fungal mycelia, which later became antroliths, was verified. This article reports a rare case of the accidental discovery of a maxillary antrolith associated with noninvasive aspergillosis in an immunocompetent and asymptomatic 56-year-old woman. The diagnosis and therapeutic procedures used in treating the patient are discussed as well as the probable iatrogenic origin of the fungal pathology.

Study of the decay Bs0→J/ψf2′(1525) in μ +μ -K +K - final states

We investigate the decay Bs0→J/ψK +K - for invariant masses of the K +K - pair in the range 1.35of 10.4fb -1 of pp̄ collisions at √s=1.96TeV accumulated with the D0 detector at the Fermilab Tevatron collider. From the study of the invariant mass and spin of the K +K - system, we find evidence for the two-body decay Bs0→J/ψf2′(1525) and measure the relative branching fraction of the decays Bs0→J/ψf2′(1525) and Bs0→J/ψ to be R f2′/=0.19±0.05(stat)±0.04(syst). © 2012 American Physical Society.

Searches for Higgs bosons in pp collisions at s=7 and 8 TeV in the context of four-generation and fermiophobic models

Searches are reported for Higgs bosons in the context of either the standard model extended to include a fourth generation of fermions (SM4) with masses of up to 600 GeV or fermiophobic models. For the former, results from three decay modes (ττ, WW, and ZZ) are combined, whilst for the latter the diphoton decay is exploited. The analysed proton-proton collision data correspond to integrated luminosities of up to 5.1 fb-1 at 7 TeV and up to 5.3 fb-1 at 8 TeV. The observed results exclude the SM4 Higgs boson in the mass range 110-600 GeV at 99% confidence level (CL), and in the mass range 110-560 GeV at 99.9% CL. A fermiophobic Higgs boson is excluded in the mass range 110-147 GeV at 95% CL, and in the range 110-133 GeV at 99% CL. The recently observed boson with a mass near 125 GeV is not consistent with either an SM4 or a fermiophobic Higgs boson. © 2013 CERN.

Telenomus remus Nixon Egg Parasitization of Three Species of Spodoptera Under Different Temperatures

Telenomus remus Nixon is a promising biocontrol agent as an egg parasitoid of Spodoptera spp., but the lack of information on the host-parasitoid interactions in this system precludes its applied use in agriculture. Therefore, we studied the parasitism capacity of T. remus on eggs of Spodoptera cosmioides (Walker), Spodoptera eridania (Cramer), and Spodoptera frugiperda (Smith) in a range of temperatures (19, 22, 25, 28, 31, and 34 ± 1°C) under controlled conditions (70 ± 10% RH and 12 h photophase). Egg masses of Spodoptera spp. were offered to a single-mated T. remus female on a daily basis. More than 80% lifetime parasitism on eggs of S. cosmioides, S. frugiperda, and S. eridania was reached from 1 to 5, 1 to 7, and 1 to 9 days, respectively, at temperatures from 19 to 34°C. More than 80% parasitization was obtained at extreme temperatures for all hosts studied. Lifetime parasitization of S. frugiperda, S. cosmioides, and S. eridania was affected by temperature, with the lowest values for S. frugiperda (34°C) and S. cosmioides (19 and 34°C). Parasitization of S. eridania eggs was reduced around 18% at 28 and 31°C, but dropped more severely at 34°C. Parasitoid longevity was reduced as temperature increased. Thus, our data indicated that T. remus might be suitable as a biocontrol agent against S. eridania, S. cosmioides, and S. frugiperda in geographical areas that fit the temperature range studied here, even though T. remus parasitism was reduced at 34°C. © 2013 Sociedade Entomológica do Brasil.

Rapid purification of serine proteinases from Bothrops alternatus and Bothrops moojeni venoms

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Search for anomalous production of highly boosted Z bosons decaying to mu(+)mu(-) in proton-proton collisions at root s=7 TeV

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)