Structural and functional characterization of an acidic platelet aggregation inhibitor and hypotensive phospholipase A(2) from Bothrops jararacussu snake venom

An acidic (pI similar to 4.5) phospholipase A(2) (BthA-I-PLA(2)) was isolated from Bothrops jararacussu snake venom by ion-exchange chromatography on a CM-Sepharose column followed by reverse phase chromatography on an RP-HPLC C-18 column. It is an similar to13.7 kDa single chain Asp49 PLA(2) with approximately 122 amino acid residues, 7 disulfide bridges, and the following N-terminal sequence: 'SLWQFGKMINYVMJGESGVLQYLSYGCYCGLGGQGQPTDATDRCCFVHDCC(51). Crystals of this acidic protein diffracted beyond 2.0 Angstrom resolution. These crystals are monoclinic and have unit cell dimensions of a = 33.9, b = 63.8, c = 49.1 Angstrom, and beta = 104.0degrees. Although not myotoxic, cytotoxic, or lethal, the protein was catalytically 3-4 tithes more active than BthTX-II, a basic D49 myotoxic PLA(2) from the same venom and other Bothrops venoms. Although it showed no toxic activity, it was able to induce time-independent edema, this activity being inhibited by EDTA. In addition, BthA-I-PLA(2) caused a hypotensive response in the rat and inhibited platelet aggregation, Catalytic, antiplatelet and other activities were abolished by chemical modification with 4-bromophenacyl bromide, which is known to covalently bind to His48 of the catalytic site. Antibodies raised against crude B. jararacussu venom recognized this acidic PLA(2), while anti-Asp49-BthTX-II recognized it weakly and anti-Lys49-BthTX-I showed the least cross-reaction. These data confirm that myotoxicity does not necessarily correlate with catalytic activity in native PLA(2) homologues and that either of these two activities may exist alone. BthA-I-PLA(2), in addition to representing a relevant molecular model of catalytic activity, is also a promising hypotensive agent and platelet aggregation inhibitor for further studies. (C) 2002 Elsevier B.V. All rights reserved.

Morphological description of the immatures of the ant, Monomorium floricola

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Contribuições para o trabalho com valores em Educação Ambiental

Neste artigo discute-se o trabalho com valores em Educação Ambiental, o que exige uma fundamentação e posicionamento adequados. Diante do impasse entre posições relativistas e universalistas para a educação em valores, aponta-se para a necessidade de explicitar nossa posição e ação em favor dos valores ambientalmente desejáveis, considerando que as questões envolvidas com o meio ambiente dizem respeito à vida e à sobrevivência de todos os seres do planeta. Estes valores podem ser identificados junto aos princípios presentes no Tratado de educação global para sociedades sustentáveis e responsabilidade global, apresentado pela sociedade civil na ECO-92. Por fim, ressalta-se a necessidade de se desenvolverem estratégias educativas que envolvam as dimensões aqui denominadas de cognição, afetividade e ação, resultando em um trabalho abrangente, que amplie as possibilidades de o indivíduo apreender, de maneira mais efetiva, um dado valor, tendo, então, melhores condições de construí-lo em sua vida.

O idoso e a ressignificação emocional do lazer

A sociedade contemporânea vê-se desafiada a responder qualitativamente às demandas da ciência e da tecnologia, cujas ressonâncias afetam as múltiplas dimensões humanas. Uma delas, o aumento da longevidade, vem requisitando políticas e programas sociais voltados à qualidade de vida, incluindo o âmbito do lazer. Este estudo qualitativo objetivou identificar aspectos emocionais na percepção de idosos, durante vivências no lazer. Os dados foram coletados por meio de questionário misto, aplicado a uma amostra de 20 participantes, de ambos os sexos. Foram analisados descritivamente pela Técnica de Análise de Conteúdo, revelando recorrências de crescimento positivo como a relação interpessoal e o respeito mútuo, a contemplação, a sensação de harmonia com a natureza, o elemento lúdico, entre outros, também responsáveis pelo vínculo afetivo do grupo. Conclui-se que experiências significativas no âmbito do lazer, capazes de contemplar a gama de necessidades e expectativas do homem, contribuem para a ressignificação emocional do lazer nesta fase do desenvolvimento.

Effect of the addition of silanated silica on the mechanical properties of microwave heat-cured acrylic resin

Effect of the addition of silanated silica on the mechanical properties of microwave heat-cured acrylic resinObjectives: The purpose of this study was to evaluate the flexural strength and Vickers hardness of a microwave energy heat-cured acrylic resin by adding different concentrations of silane surface-treated nanoparticle silica.Methods: Acrylic resin specimens with dimensions of 65 x 10 x 2.5 mm were formed and divided into five experimental groups (n = 10) according to the silica concentration added to the acrylic resin mass (weight %) prior to polymerisation : G1, without silica; G2, 0.1% silica; G3, 0.5% silica; G4, 1.0% silica; and G5, 5.0% silica. The specimens were submitted to a three-point flexural strength test and to the Vickers hardness test (HVN). The data obtained were statistically analysed by ANOVA and the Tukey test (alpha = 0.05).Results: Regarding flexural strength, G5 differed from the other experimental groups (G1, G2, G3 and G4) presenting the lowest mean, while G4 presented a significantly higher mean, with the exception of group G3. Regarding Vickers hardness, a decrease in values was observed, in which G1 presented the highest hardness compared with the other experimental groups.Conclusion: Incorporating surface-treated silica resulted in direct benefits in the flexural strength of the acrylic resin activated by microwave energy; however, similar results were not achieved for hardness.

In Vitro Assessment of Chemical Activation Efficiency During In-office Dental Bleaching

Purpose: This study compared five types of chemical catalyzing agents added to 35% hydrogen peroxide gel, with regard to their capacity of intensifying in-office dental bleaching results.Methods: One-hundred and twenty bovine incisors were used, of which the crowns and roots were cut in the incisor-apical direction, to acquire the dimensions of a human central incisor. The specimens were sectioned in the mesiodistal direction by means of two longitudinal cuts, the lingual halves being discarded. The vestibular halves received prophylaxis with a bicarbonate jet, ultrasound cleaning and acid etching on the dentinal portion. Next, the specimens were stored in receptacles containing a 25% instant coffee solution for two weeks. After the darkening period, initial measurement of the shade obtained was taken with the Easy Shade appliance, which allowed it to be quantified by the CIELab* method. The samples were divided into six groups, corresponding to the chemical activator used: a) none (CON); b) ferric chloride (CF); c) ferrous sulphate (SF); d) manganese gluconate (GM); e) manganese chloride (CM); f) mulberry root extract (RA). Each group received three 10-minute applications of the gels containing the respective activating agents. Next, a new shade measurement was made.Results: The Analysis of Variance and Tukey tests (alpha=5%) showed statistically significant differences for the shade perception values (p=0.002). Groups GM, CM and RA showed significantly higher means than the control group.Conclusion: The presence of some chemical activators is capable of resulting in a significant increase in tooth shade variation.

Combinatorial identities and quantum state densities of supersymmetric sigma models on N-folds

There is a remarkable connection between the number of quantum states of conformal theories and the sequence of dimensions of Lie algebras. In this paper, we explore this connection by computing the asymptotic expansion of the elliptic genus and the microscopic entropy of black holes associated with (supersymmetric) sigma models. The new features of these results are the appearance of correct prefactors in the state density expansion and in the coefficient of the logarithmic correction to the entropy.

The effect of cooling rate during hydrothermal synthesis of ZnO nanorods

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Influence of Hydrothermal Synthesis Conditions and Device Configuration on the Photoresponse of UV Sensors Based on ZnO Nanorods

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Interference of vaccinal antibodies on serological diagnosis of leptospirosis in vaccinated buffalo using two types of commercial vaccines

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Spatial distribution of arboviral mosquito vectors (Diptera, Culicidae) in Vale do Ribeira in the South-eastern Brazilian Atlantic Forest

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Ultrasonographic and ecobiometric findings in the eyes of adult goats

Conhecer o aspecto e as dimensões de olhos de cabras facilita o uso da ultrassonografia na avaliação de doenças oculares. O objetivo do presente trabalho foi o de avaliar os achados ultrassonográficos e ecobiométricos em olhos de cabras adultas. Ultrassonogramas nos modos A e B foram realizados em 30 caprinos adultos (60 olhos) (n=15 fêmeas intactas e n=15 machos castrados). O exame ultrassonográfico foi realizado após a instilação de colírio anestésico. Gel a base de água foi utilizado sobre o transdutor de 20 MHz posicionado-o de forma longitudinasobre a córneal, até que imagens no modo B estivessem de acordo com os ecos gerados pelo modo A. Utilizou-se análise estatística para se comparar os achados ecobiométricos entre os sexos (p<0,05). As médias com seus respectivos desvios padrões das estruturas oculares em machos e fêmeas foram, respectivamente, 3,46±0,55, 3,33±0,46mm (profundidade da câmara anterior); 8,60±0,34, 8,65±0,39mm (espessura da lente); 11,34±0,61, 11,39±0,66mm (profundidade da câmara vítrea) e 23,43±0,92, 23,39±0.86mm (comprimento axial do bulbo ocular). Não foi observada diferença significativa entre os olhos direito e esquerdo, assim como entre machos e fêmeas (p>0,05). O aspecto ultrassonográfico de olhos de cabras se assemelha com o de outras espécies domésticas e silvestres.

Nest architecture of the leaf-cutting ant Acromyrmex rugosus rugosus

The prominent nests mounds of many ant species are one of the most obvious signs of their presence, yet the subterranean architecture of nests is often poorly known. The present work aimed to establish the external and internal structure of nests of a species of leaf-cutting ant, Acromyrmex rugosus rugosus, by either marking the interior of nests with talcum powder, or forming casts with cement. Twelve nests were excavated and surveyed, with eight being marked with talcum powder and four cast with cement. The external and internal structure of the nests was highly variable. The largest and smallest nests had mound areas of 9.89 m(2) and 0.01 m(2) respectively. The number of chambers found ranged from I to 26, with maximum dimensions of between 6 and 70 cm. Chambers were found close to the soil surface (6 cm) down to a maximum depth of 3.75 m. In addition to chambers containing fungus garden, some chambers were found to be empty, filled with soil or filled with waste, the first time this has been recorded in a species of Acromyrmex. The nests of A. rugosus rugosus appear to be unusually complex for the genus, containing a diversity of irregular chambers and tunnels.

Identification and characterization of different accessions of itchgrass (Rottboellia cochinchinensis)

Studies were conducted to identify and characterize different accessions of itchgrass. Seeds were collected in the counties of Aramina, Campinas, Dumont, Igarapava, Jaboticabal, and Ribeirao Preto, all in the state of São Paulo, Brazil. Accessions were characterized based on dimensions of their stomata, stomatal index (SI), and length and width of their seed (caryopses and husk). Chromosome number and length also were determined, and accessions were further differentiated using molecular markers (polymerase chain reaction [PCR]). Itchgrass from Ribeirao Preto had much longer and narrower seeds than those from the other locations, and their husks were longer as well. Accessions had similar SIs, both on the abaxial and adaxial leaf surfaces. Stomata from Campinas and Igarapava accessions were longer and wider, whereas those from Dumont and Ribeirao Preto were similar and smaller than all others. The accession from Ribeirao Preto is diploid (2n = 20); the rest are polyploid, with the total length of chromosomes smaller than all others. These differences were confirmed by molecular differentiation (PCR).

Crystallization and preliminary X-ray diffraction analysis of a novel Arg49 phospholipase A(2) homologue from Zhaoermia mangshanensis venom

Zhaoermiatoxin, an Arg49 phospholipase A(2) homologue from Zhaoermia mangshanensis (formerly Trimeresurus mangshanensis, Ermia mangshanensis) venom is a novel member of the PLA(2)-homologue family that possesses an arginine residue at position 49, probably arising from a secondary Lys49 -> Arg substitution that does not alter the catalytic inactivity towards phospholipids. Like other Lys49 PLA(2) homologues, zhaoermiatoxin induces oedema and strong myonecrosis without detectable PLA(2) catalytic activity. A single crystal with maximum dimensions of 0.2 x 0.2 x 0.5 mm was used for X-ray diffraction data collection to a resolution of 2.05 angstrom using synchrotron radiation and the diffraction pattern was indexed in the hexagonal space group P6(4), with unit-cell parameters a = 72.9, b = 72.9, c = 93.9 angstrom.