Earth: A Wandering

Earth is the name of our planet and of an element from which we emerge. Pre-modern and non-modern traditions show us how to live at this conjunction better than many modern simulacra. This reflection examines in particular early medieval Christian tradition, set in dialogue with the emerging twenty-first-century field of ecosemiotics, while wandering from the Susquehanna Valley to Middle-earth.

Cupiennin 1a, an antimicrobial peptide from the venom of the neotropical wandering spider Cupiennius salei, also inhibits the formation of nitric oxide by neuronal nitric oxide synthase

Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 +/- 0.3 microM. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.

Famous musicians of a wandering race : biographical sketches of outstanding figures of Jewish origin in the musical world

by Gdal Saleski

The Jew and civilization

by Ada Sterling

Christian and Jew : a symposium for better understanding

ed. by Isaac Landman

I am a woman - and a Jew

by Leah Morton

The court jew Lippold : tale of a sixteenth century martyrdom

narrated by George Alexander Kohut

Auto de fé and Jew

by Elkan Nathan Adler

The Polish Jew : his social and economic value

by Beatrice C. Baskerville

England under the heel of the Jew : a tale of 2 books

arranged by the author of "The Call of the sword" [d.i. John Henry Clarke]

The real Jew : some aspects of the Jewish contribution to civilization

ed. by H. Newman

The Jew in South Africa

by J. H. Hertz