865 resultados para Low water activity


Relevância:

80.00% 80.00%

Publicador:

Resumo:

La presente tesis doctoral surge ante la necesidad de completar el estudio sobre la corrosión en el hormigón armado expuesto al ambiente marino iniciado por D. Miguel Ángel Bermúdez Odriozola en 2007 con la tesis doctoral con título “Corrosión de las armaduras del hormigón armado en ambiente marino: zona de carrera de mareas y zona sumergida”. Una vez realizado el estudio bibliográfico, se ha planteado un estudio experimental en el que se analizan cuatro muelles de distintas edades y localizados en distintos lugares de la geografía española. Uno de ellos contiene adiciones en el hormigón. Una vez inspeccionados, se extraen testigos de cada uno de ellos con el fin de realizar ensayos de caracterización y se analizan sus resultados en paralelo con los coeficientes de difusión. Uno se los objetivos ha sido comprobar el mejor método de ensayo que permita controlar la durabilidad del hormigón en ambiente IIIa. La tesis que se presenta ha demostrado la efectividad del ensayo de penetración de agua para discriminar los hormigones que presentarán un buen comportamiento frente a la difusión de cloruros y por tanto para predecir la vida útil de la estructura. Asimismo, otro objetivo ha sido valorar el uso de adiciones en el hormigón y cómo afectan a la mejora del comportamiento del hormigón expuesto al ambiente marino. Se han obtenido valores del coeficiente de eficacia de cenizas volantes y humo de sílice frente a la difusión de cloruros, muy superiores a los actualmente considerados en términos de resistencia. El ambiente marino aéreo engloba estructuras situadas en primera línea de costa así como aquellas que se sitúan hasta 5km de distancia de la línea del mar. La investigación realizada ha demostrado la necesidad de establecer una nueva subdivisión en este ambiente introduciendo la zona Spray, siguiendo criterios internacionales, que permita diferenciar la zona más desfavorable del mismo que comprende las estructuras ubicadas sobre el nivel del mar tal como los tableros de pantalanes portuarios estudiados. Se han analizado en profundidad los valores del contenido de cloruros en superficie de hormigón en los diferentes tipos de ambiente marino recogidos por la Instrucción EHE- 08 contrastando los requisitos normativos. Como conclusión se han hecho nuevas propuestas normativas que afectan al ambiente sumergido y al ambiente marino aéreo (zona spray). Asimismo se ha realizado un análisis en profundidad de la concentración crítica de cloruros recogida por la Instrucción EHE-08, a partir de los datos obtenidos en estructuras reales. Se ha evaluado el ensayo de resistividad para estimar el valor del coeficiente de difusión de cloruros. Este ensayo ha demostrado su efectividad para discriminar hormigones con adiciones y con muy baja penetración de agua, si bien no resulta sensible para detectar hormigones con elevada permeabilidad. Finalmente en la tesis se ha obtenido un modelo de difusión de cloruros (a/c-D) en ambiente marino aéreo a fin de poder estimar la difusión de cloruros en el hormigón a partir de un requisito normativo como es la relación a/c. This Thesis is focussed to complete the previous study on the corrosion of reinforced concrete exposed to marine environment, carried out by Dr. Miguel Ángel Bermúdez Odrizola in 2007. That Thesis title was “Corrosion of concrete reinforcement located in marine environment: tidal zone and submerged zone”. After the literature review presented in the State of the Art, an experimental programme was carried out. Four docks of different ages and locations have been studied, one of them was a fly ash concrete. The structures were inspected on site and several cores extracted in order to develop characterization tests and obtain diffusion profiles at the laboratory. One of the objectives has been to check the best laboratory test method to control concrete durability when exposed to atmospheric marine environment. This Thesis has proven the effectiveness of the water penetration test to differentiate concretes well behaved against chloride diffusion and also to predict the structure service life. Another objective has been to study the effect of mineral additions in concrete and how they improve the durability of concrete in this environment. Efficiency factors have been obtained for fly ashes and silica fume, much higher than those consider for strength. According to the Spanish Concrete Code EHE 08, the atmospheric marine environment includes structures located at the cost, from the sea line up to 5km inland. The research conducted has shown the need to consider a spray zone which is the most unfavourable area of the atmospheric environment, affecting structures over the sea level as the decks of the wharves here studied. Surface chloride contents of structures in the different marine environments have been deeply analysed, checking the actual standard limits. As a conclusion, new normative values have been proposed for submerged and atmospheric zone (spray zone). A complete analysis of the chloride threshold concentration from the data obtained in real structures has also been performed. It has been evaluated the resistivity test as a tool to estimate the chloride diffusion coefficient. This test has proven effectiveness to discriminate concrete with mineral additions and low water penetration values, while it is not sensitive to detect concretes with high permeability. Finally, a chloride diffusion model (w/c) has been obtained in atmospheric marine environment in order to estimate the chloride diffusion of the concrete knowing a normative requirement as w/c.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

El presente trabajo estudia el empleo del olmo de Siberia (Ulmus Pumila L.) y el chopo (Populus spp.) en corta rotación y alta densidad para la producción de biomasa con fines energéticos. En el área mediterránea las disponibilidades hídricas son limitadas, por lo que la mayoría de los cultivos energéticos utilizados hasta el momento requieren el aporte de agua de riego; por ello resulta fundamental encontrar especies con bajos requerimientos hídricos, analizar la eficiencia en el uso del agua de diferentes materiales genéticos y optimizar la dosis de riego. Las parcelas experimentales se ubicaron en la provincia de Soria. En el ensayo llevado a cabo con olmo de Siberia se ha analizado el efecto en la producción de la disponibilidad de agua mediante el establecimiento de parcelas en secano y con dos dosis de riego (2000 m3 ha-1 año-1 y 4000 m3 ha-1 año-1 aproximadamente); además, al ser una especie poco estudiada hasta el momento, se ha estudiado también el efecto que tiene sobre el rendimiento la densidad de plantación (3.333 plantas ha-1 y 6.666 plantas ha-1), el tipo de suelo (2 calidades diferentes) y el turno de corta (3 y 4 años). En el caso del chopo, se han evaluado cuatro clones (AF-2, I-214, Monviso y Pegaso) establecidos con una densidad de 20.000 plantas por hectárea. Durante el primer ciclo de tres años se aportó el mismo volumen de riego a todas las parcelas, mientras que durante el segundo ciclo se establecieron 8 regímenes hídricos diferentes. Por otra parte, se ha investigado sobre el uso del potencial hídrico de las plantas para evaluar el estrés hídrico de las mismas y se ha estimado la producción de biomasa foliar y el Índice de Área Foliar (LAI) de ambas especies, relacionando los valores obtenidos con la dosis de riego y la producción de biomasa. Los resultados muestran que los suelos inundados reducen la tasa de supervivencia de los olmos durante el periodo de implantación, sin embargo la mortalidad durante los siguientes periodos vegetativos es baja y muestra buena capacidad de rebrote. La productividad (kg ha-1 año-1) obtenida fue mayor con un turno de corta de cuatro años que con turno de tres años. El área basal y la altura fueron variables eficaces para predecir la producción de biomasa del olmo de Siberia, obteniendo una variabilidad explicada de más del 80%. En cuanto a los parámetros que mayor influencia tuvieron sobre el crecimiento, el tipo de suelo resulto ser el más relevante, obteniéndose en un suelo agrícola considerado de buena calidad una producción en condiciones de secano de unos 8.000 kg ha-1 año-1. En condiciones de regadío el rendimiento del olmo de Siberia fue al menos el doble que en secano, pero la diferencia entre las dos dosis de riego estudiadas fue pequeña. La producción de biomasa fue mayor en la densidad de plantación más alta (6.666 plantas ha–1) en las parcelas de regadío, sin embargo no se encontraron diferencias significativas entre las dos densidades en secano. El clon de chopo que presentó un mayor rendimiento durante el primer ciclo fue AF-2, alcanzando los 14.000 kg ha-1 año-1, sin embargo la producción de este clon bajó sustancialmente durante el segundo ciclo debido a su mala capacidad de rebrote, pasando a ser I-214 el clon más productivo llegando también a los 14.000 kg ha-1 año-1. Un aporte adicional de agua proporcionó un incremento de la biomasa recogida, pero a partir de unos 6.500 m3 ha-1 año-1 de agua la producción se mantiene constante. El potencial hídrico foliar ha resultado ser una herramienta útil para conocer el estrés hídrico de las plantas. Los olmos de regadío apenas sufrieron estrés hídrico, mientras que los implantados en condiciones de secano padecieron un acusado estrés durante buena parte del periodo vegetativo, que se acentuó en la parte final del mismo. Los chopos regados con las dosis más altas no sufrieron estrés hídrico o fue muy pequeño, en las dosis intermedias sufrieron un estrés moderado ocasionalmente y únicamente en las dosis más bajas sufrieron puntualmente un estrés severo. El LAI aumenta con la edad de los brotes y oscila entre 2 y 4 m2 m−2 en los chopos y entre 2 y 7 m2 m−2 en los olmos. Se encontró una buena relación entre este índice y la producción de biomasa del olmo de Siberia. En general, puede decirse que el olmo de Siberia podría ser una buena alternativa para producir biomasa leñosa en condiciones de secano, mientras que el chopo podría emplearse en regadío siempre que se haga una buena elección del clon y de la dosis de riego. ABSTRACT This work explores the possibilities of biomass production, for energy purposes, of Siberian elm (Ulmus Pumila L.) and poplar (Populus spp.) in Spain. Irrigation is required for the viable cultivation of many energy crops in Mediterranean areas because of low water availability, for this reason species with low water requirements should be a good alternative for biomass production. Moreover, the optimal amount of irrigation water and the performance of the different genetic material in terms of production and water use efficiency should be studied in order to use water wisely. The experimental plots were established in the province of Soria in Spain. Given the small amount of information available about Siberian elm, besides studying the influence of water availability (rain-fed and two different irrigation doses) on biomass production, two different plantation densities (3,333 plants ha-1 and 6,666 plants ha-1), two different soil type and two cutting cycles (three years and four years) were assessed. In the case of poplar, four clones belonging to different hybrids (I-214, AF2, Pegaso, and Monviso) were included in a high density plantation (20,000 plants ha-1). During the first cycle, the water supplied in all plots was the same, while 8 different watering regimes were used during the second cycle. The suitability of the use of the leaf water potential to assess the water stress situations has also been investigated. Moreover, leaf biomass production and leaf area index (LAI) were estimated in both species in order to analyze the relationship between these parameters, irrigation dose and biomass production. The results shows that flooded soils have an adverse effect on elm survival in the implantation period, but the percentage of mortality is very low during the following vegetative periods and it shows a good ability of regrowth. The annual yield from a four-year cutting cycle was significantly greater than that from the three-year cutting cycle. Basal diameter and height are effective variables for predicting the production of total biomass; equations with R squared higher than 80% were obtained. The analysis of parameters having an influence on elm growth shows that soil type is the most important factor to obtain a good yield. In soils with enough nutrients and higher waterholding capacity, biomass productions of 8,000 kg ha-1 yr-1 were achieved even under rain-fed conditions. In irrigated plots, Siberian elm production was double than the production of biomass under rain-fed conditions; however, small differences were obtained between the 2 different irrigation doses under study. Biomass yield was greater for the highest planting density (6,666 plants ha–1) in irrigated plots, but significant differences were not found between the 2 densities in rain-fed plots. The clone AF-2 showed the highest production (14,000 kg ha-1 yr-1) during the first cycle, however during the second cycle its growth was lower because of a high mortality rate after regrowth and I-214 achieves the greatest production (14,000 kg ha-1 yr-1). An additional water supply provided a greater amount of biomass, but over about 6500 m3 ha-1 yr-1 of water the production is constant. Leaf water potential has been shown to be a useful tool for finding out plant water status. Irrigated elms hardly suffered water stress, while rain-fed elms suffered a pronounced water stress, which was more marked at the end of the vegetative period. Most of poplars did not show water stress; leaf water potentials only showed an important water stress in the plots irrigated with the lowest doses. LAI increases with shoot age and it ranges from 2 to 4 m2 m−2 in poplars and from 2 to 7 m2 m−2 in elms. A good relationship has been found between this index and Siberian elm production. In general, Siberian elm could be a good alternative to produce woody biomass in rainfed plots, while poplar could be used in irrigated plots if a suitable clone and irrigation dose are chosen.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

In the practice of “osmotic stress,” the effect of excluded cosolvents on a biochemical equilibrium is interpreted as the number of water molecules participating in the reaction. This action is attributed to lowering of solvent water activity by the cosolvent. This concept of osmotic stress in disperse solution is erroneous: (i) A cosolvent cannot be both excluded and inert, i.e., noninteracting, because exclusion requires a positive free energy change; (ii) a decrease in water activity alone by addition of solute cannot affect an equilibrium when the reacting surface is in contact with the solvent; and (iii) osmotic stress in disperse solution is a restricted case of preferential interactions; the reaction is driven by the free energy of cosolvent exclusion, and the derived number of water molecules is solely a measure of the mutual perturbations of the chemical potentials of the cosolvent and the protein.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

We have used in vitro evolution to probe the relationship between stability and activity in a mesophilic esterase. Previous studies of these properties in homologous enzymes evolved for function at different temperatures have suggested that stability at high temperatures is incompatible with high catalytic activity at low temperatures through mutually exclusive demands on enzyme flexibility. Six generations of random mutagenesis, recombination, and screening stabilized Bacillus subtilis p-nitrobenzyl esterase significantly (>14°C increase in Tm) without compromising its catalytic activity at lower temperatures. Furthermore, analysis of the stabilities and activities of large numbers of random mutants indicates that these properties are not inversely correlated. Although enhanced thermostability does not necessarily come at the cost of activity, the process by which the molecule adapts is important. Mutations that increase thermostability while maintaining low-temperature activity are very rare. Unless both properties are constrained (by natural selection or screening) the evolution of one by the accumulation of single amino acid substitutions typically comes at the cost of the other, regardless of whether the two properties are inversely correlated or not correlated at all.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

It has been demonstrated that shortened forms of (stem II-deleted) hammerhead ribozymes with low intrinsic activity form very active dimers with a common stem II (very active short ribozymes capable of forming dimers were designated maxizymes). Intracellular activities of heterodimeric maxizymes and conventional ribozymes, under the control of a human tRNAVal-promoter, were compared against the cleavage of HIV-1 tat mRNA. The pol III-driven maxizymes formed very active heterodimers, and they successfully cleaved HIV-1 tat mRNA in mammalian cells at two sites simultaneously. The cleaved fragments were identified directly by Northern blotting analysis. Despite the initial concerns that a complicated dimerization process and formation of inactive homodimers were involved in addition to the process of association with the target, the overall intracellular activities of tRNAVal-driven maxizymes were significantly higher in mammalian cells than those of two sets of independent, conventional hammerhead ribozymes that were targeted at the same two sites within HIV-1 tat mRNA. Because the tRNAVal-driven maxizymes tested to date have been more effective than tRNAVal-driven “standard” hammerhead ribozymes, the tRNAVal-driven heterodimeric maxizymes appear to have potential utility as gene-inactivating agents.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Tomato (Lycopersicon esculentum) plants were transformed with gene constructs containing a tomato alcohol dehydrogenase (ADH) cDNA (ADH 2) coupled in a sense orientation with either the constitutive cauliflower mosaic virus 35S promoter or the fruit-specific tomato polygalacturonase promoter. Ripening fruit from plants transformed with the constitutively expressed transgene(s) had a range of ADH activities; some plants had no detectable activity, whereas others had significantly higher ADH activity, up to twice that of controls. Transformed plants with fruit-specific expression of the transgene(s) also displayed a range of enhanced ADH activities in the ripening fruit, but no suppression was observed. Modified ADH levels in the ripening fruit influenced the balance between some of the aldehydes and the corresponding alcohols associated with flavor production. Hexanol and Z-3-hexenol levels were increased in fruit with increased ADH activity and reduced in fruit with low ADH activity. Concentrations of the respective aldehydes were generally unaltered. The phenotypes of modified fruit ADH activity and volatile abundance were transmitted to second-generation plants in accordance with the patterns of inheritance of the transgenes. In a preliminary taste trial, fruit with elevated ADH activity and higher levels of alcohols were identified as having a more intense “ripe fruit” flavor.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

In yeast, commitment to cell division (Start) is catalyzed by activation of the Cdc28 protein kinase in late G1 phase by the Cln1, Cln2, and Cln3 G1 cyclins. The Clns are essential, rate-limiting activators of Start because cells lacking Cln function (referred to as cln-) arrest at Start and because CLN dosage modulates the timing of Start. At or shortly after Start, the development of B-type cyclin Clb-Cdc28 kinase activity and initiation of DNA replication requires the destruction of p40SIC1, a specific inhibitor of the Clb-Cdc28 kinases. I report here that cln cells are rendered viable by deletion of SIC1. Conversely, in cln1 cln2 cells, which have low CLN activity, modest increases in SIC1 gene dosage cause inviability. Deletion of SIC1 does not cause a general bypass of Start since (cln-)sic1 cells remain sensitive to mating pheromone-induced arrest. Far1, a pheromone-activated inhibitor of Cln-Cdc28 kinases, is dispensable for arrest of (cln-)sic1 cells by pheromone, implying the existence of an alternate Far1-independent arrest pathway. These observations define a pheromone-sensitive activity able to catalyze Start only in the absence of p40SIC1. The existence of this activity means that the B-type cyclin inhibitor p40SIC1 imposes the requirement for Cln function at Start.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Adenylyl cyclase activity can be reconstituted by simple mixture of the two cytosolic domains of the enzyme after their independent synthesis in Escherichia coli. We have synthesized and purified the C1a domain of type I adenylyl cyclase and the C2 domain of the type II enzyme to assess their interactions with each other and with the activators Gsalpha and forskolin. In the absence of an activator, the fragments associate with low affinity and display low catalytic activity. This basal activity can be stimulated more than 100-fold by either forskolin or activated Gsalpha. Further, the addition of these activators increases the apparent affinity of the fragments for each other. Stimulation of catalysis by Gsalpha and forskolin is synergistic. These data suggest a model wherein either Gsalpha or forskolin enhances association of the other activator with adenylyl cyclase, as well as facilitating the interaction between the C1 and C2 domains of the enzyme.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Recent studies have demonstrated that the overexpression of the c-myc gene in the liver of transgenic mice leads to an increase in both utilization and accumulation of glucose in the liver, suggesting that c-Myc transcription factor is involved in the control of liver carbohydrate metabolism in vivo. To determine whether the increase in c-Myc might control glucose homeostasis, an intraperitoneal glucose tolerance test was performed. Transgenic mice showed lower levels of blood glucose than control animals, indicating that the overexpression of c-Myc led to an increase of blood glucose disposal by the liver. Thus, the increase in c-Myc might counteract diabetic hyperglycemia. In contrast to control mice, transgenic mice treated with streptozotocin showed normalization of concentrations of blood glucose, ketone bodies, triacylglycerols and free fatty acids in the absence of insulin. These findings resulted from the normalization of liver metabolism in these animals. While low glucokinase activity was detected in the liver of diabetic control mice, high levels of both glucokinase mRNA and enzyme activity were noted in the liver of streptozotocin-treated transgenic mice, which led to an increase in intracellular levels of glucose 6-phosphate and glycogen. The liver of these mice also showed an increase in pyruvate kinase activity and lactate production. Furthermore, normalization of both the expression of genes involved in the control of gluconeogenesis and ketogenesis and the production of glucose and ketone bodies was observed in streptozotocin-treated transgenic mice. Thus, these results suggested that c-Myc counteracted diabetic alterations through its ability to induce hepatic glucose uptake and utilization and to block the activation of gluconeogenesis and ketogenesis.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

A diuretic hormone of unusual structure was isolated from extracts of whole heads of the mealworm Tenebrio molitor. The hormone is a 37-aa peptide of 4371 Da, with the sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN. This peptide increases cAMP production in Malpighian tubules of T. molitor. The amino acid sequence reveals that this peptide is a member of the family of sauvagine/corticotropin-releasing factor/urotensin I-related insect diuretic hormones. The C-terminal sequence of this peptide is quite different from other members of this family, which have a hydrophobic C terminus (isoleucinamide or valinamide). When aligned comparably, T. molitor diuretic hormone has a more hydrophilic C terminus, leucylasparagine (free acid). In contrast to all other known diuretic hormones of this family, this peptide has exceptionally low stimulatory activity on cAMP production in Malpighian tubules of Manduca sexta. However, at nanomolar concentrations it stimulates cAMP production in Malpighian tubules of T. molitor. Diuretic hormones of this family have been isolated previously from Lepidoptera, Orthoptera, Dictyoptera, and Diptera. This appears to be the first diuretic hormone isolated from a coleopteran insect.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

Feline immunodeficiency virus (FIV) encodes the enzyme deoxyuridine-triphosphatase (DU; EC 3.6.1.23) between the coding regions for reverse transcriptase and integrase in the pol gene. Here, we report the in vivo infection of cats with a DU- variant of the PPR strain of FIV and compare its growth properties and tissue distribution with those of wild-type FIV-PPR. The results reveal several important points: (i) DU- FIV is able to infect the cat, with kinetics similar to that observed with wild-type FIV; (ii) both wild-type and DU- FIV-infected specific-pathogen free cats mount a strong humoral antibody response which is able to limit the virus burden in both groups of animals; (iii) the virus burden is reduced in the DU- FIV-infected cats, particularly in tissues such as spleen and salivary gland; and (iv) the mutation frequency in DU- FIVs integrated in the DNA of primary macrophages after 9 months of infection is approximately 5-fold greater than the frequency observed in DU- FIV DNA integrated in T lymphocytes. Mutation rate with wild-type FIV remains the same in both cell types in vivo. The dominant mutations seen in macrophages with DU- FIV are G-->A base changes, consistent with an increased misincorporation of deoxyuridine into viral DNA of DU- FIVs during reverse transcription. Because this enzyme is absent from human immunodeficiency virus type 1 and other primate lentiviruses, virus replication in cell environments with low DU activity may lead to increased mutation and contribute to the rapid expansion of the viral repertoire.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

During my PhD course, I focused my research on antimicrobial peptides (AMPs), in particular on the aspects of their computational design and development. This work led to the development of a new family of AMPs that I designed, starting from the amino acid sequence of a snake venom toxin, the cardiotoxin 1 (CTX-1) of Naja atra. Naja atra atra cardiotoxin 1, produced by Chinese cobra snakes belonging to Elapidae family, is included in the three-finger toxin family and exerts high cytotoxicity and antimicrobial activity too. This toxin family is characterized by specific folding of three beta-sheet loops (“fingers”) extending from the central core and by four conserved disulfide bridges. Using as template the first loop of this toxin, different sequences of 20 amino acids linear cationic peptides have been designed in order to avoid toxic effects but to maintain and strengthen the antimicrobial activity. As a result, the sequence NCP-0 (Naja Cardiotoxin Peptide-0) was designed as ancestor and subsequently other 4 variant sequences of NCP0 were developed. These variant sequences have shown microbicidal activity towards a panel of reference strains of Gram-positive and Gram-negative bacteria, fungi and an enveloped virus. In particular, the sequence designed as NCP-3 (Naja Cardiotoxin Peptide-3) and its variants NCP-3a and NCP-3b have shown the best antimicrobial activity together with low cytotoxicity against eukaryotic cells and low hemolytic activity. Bactericidal activity has been demonstrated by minimum bactericidal concentration (MBC) assay at values below 10 μg/ml for Pseudomonas aeruginosa ATCC 27853, Acinetobacter baumannii ( clinical isolates), Moraxella catharralis ATCC 25238, MRSA ATCC 43400, while towards Staphylococcus aureus ATCC 25923, Enterococcus hirae ATCC 10541 and Streptococcus agalactiae ATCC 13813 the bactericidal activity was demonstrated even below 1.6 μg/ml concentration. This potent antimicrobial activity was confirmed even for unicellular fungi Candida albicans, Candida glabrata and Malassezia pachydermatis (MBC 32.26-6.4 μg/ml), and also against the fast-growing mycobacteria Mycobacterium smegmatis DSMZ 43756 and Mycobacterium fortuitum DSMZ 46621 (MBC 100 μg/ml). Moreover, NCP-3 has shown a virucidal activity on the enveloped virus Bovine Herpesvirus 1 (BoHV1) belonging to herpesviridae family. The bactericidal activity is maintained in a high salt concentration (125 and 250 mM NaCl) medium and PB +20% Mueller Hinton Medium for E. coli, MRSA and Pseudomonas aeruginosa reference strains. Considering these in vitro obtained data, we propose NCP-3 and its variants NCP-3a and NCP-3b as promising antimicrobial candidates. For this reason, the whole novel AMPs family has been protected by a national patent (n°102015000015951).

Relevância:

80.00% 80.00%

Publicador:

Resumo:

O objetivo desse trabalho foi obter polpa de guavira desidratada por atomização, utilizando maltodextrina ou goma arábica como agentes carreadores. Inicialmente, avaliou-se a influência das condições de processo, temperatura do ar de secagem (130, 155 e 180) °C e vazão volumétrica da mistura (20 e 40) mL/min, o tipo e concentração de agente carreador (10 e 20) % nas características físicas, físico-químicas e atividade antioxidante do produto obtido. As propriedades analisadas foram umidade, atividade de água, higroscopicidade, solubilidade, cor, distribuição e tamanho médio de partículas, morfologia, compostos fenólicos totais e atividade antioxidante. A temperatura do ar de secagem e a vazão volumétrica de alimentação influenciaram significativamente todas as propriedades da guavira em pó. A umidade e atividade de água apresentaram os menores valores na temperatura intermediária, independentemente do tipo e concentração do carreador usado. A solubilidade das amostras adicionadas de maltodextrina foram superiores às amostras com goma arábica. O aumento da concentração de agente carreador, em geral, proporcionou um aumento no parâmetro L* e diminuição dos parâmetros a* e b*, tornando as amostras mais claras e reduzindo as tonalidades vermelha e amarela. A guavira em pó apresentou coloração próxima do amarelo e marrom, com grande variação nos parâmetros de cor C* e H* em função das diferentes condições de secagem. A distribuição do tamanho de partículas não teve um padrão definido e o tamanho médio das amostras com maltodextrina foram maiores do que as com goma arábica para a temperatura do ar a 130 °C. No entanto, para as outras temperaturas (155 e 180) °C não houve um comportamento específico do tamanho das partículas em função da vazão de alimentação, tipo e ou concentração de agente carreador. A análise de microscopia eletrônica de varredura permitiu observar que as partículas obtidas tanto com maltodextrina como goma arábica apresentaram formato esférico, superfície rugosa e com adesão de partículas menores nas de maior tamanho, sendo que a superfície das partículas com goma arábica também apresentaram concavidades. A atividade antioxidante foi superior quando utilizada a temperatura de secagem intermediária. A partir das condições selecionadas na primeira etapa (temperatura do ar de 155 °C, vazão volumétrica da mistura de 40 mL/min e 10% de maltodextrina ou goma arábica) a polpa de guavira em pó foi caracterizada quanto a temperatura de transição vítrea, as isotermas de adsorção e a estabilidade à estocagem do ácido ascórbico, compostos fenólicos totais e da atividade antioxidante da polpa de guavira em pó produzida por spray drying ao longo de 120 dias. As temperaturas de transição vítrea foram de (25,2 ± 2,7 °C e 31,4 ± 0,4) °C para os pós produzidos com goma arábica e maltodextrina, respectivamente. O modelo de BET apresentou ajuste muito bom (R2>0,99) para descrever o comportamento de sorção de água das amostras nas temperaturas de (20, 30 e 40) °C. A polpa de guavira em pó produzida com goma arábica apresentou maior adsorção de água do que as amostras obtidas com maltodextrina. No estudo da estabilidade, as amostras foram acondicionadas em embalagem de polietileno laminado e armazenadas a 25 °C e umidade relativa de 75%. A embalagem de polietileno laminado foi eficiente na manutenção do teor de ácido ascórbico e atividade antioxidante da guavira em pó por um período de 120 dias, independente do carreador adicionado. O teor de compostos fenólicos para a guavira em pó com goma arábica apresentou uma redução nos primeiros 22 dias, contudo a amostra com maltodextrina manteve-se estável durante 120 dias de armazenamento.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

A acne vulgar é uma das doenças cutâneas mais comuns, apresentando como um de seus fatores fisiopatológicos primários a colonização pelo microrganismo Propionibacterium acnes. Atualmente, têm-se buscado terapias alternativas para o combate ao P. acnes, destacando-se alguns ácidos graxos, como o ácido laúrico (LA). O LA é uma molécula pouco solúvel em água, sendo possível sua incorporação em lipossomas. Os lipossomas apresentam capacidade de encapsulação/ liberação de ativos e impedem a desidratação da pele, tornando-se ingredientes inovadores na área de cosméticos. Foram preparados lipossomas de dipalmitoilfosfatidilcolina (DPPC) contendo diferentes concentrações de LA, que variaram de 0 a 50% da concentração total em mol, em quatro pHs: 9,0, 7,4, 5,0 e 3,0. Nestes pHs o estado de protonação do LA muda variando de 0 a -1. Os lipossomas foram extrusados por filtros com poros de 100 nm de diâmetro visando à obtenção de vesículas unilamelares grandes (LUV). As LUV foram caracterizadas quanto a sua estabilidade em condições de prateleira, temperatura de transição de fase da bicamada, encapsulamento no interior aquoso, liberação do LA, difusão das vesículas na pele e seus aspectos morfológicos foram caracterizados por espalhamento de raios-X a baixo ângulo (SAXS) e crio-microscopia eletrônica de transmissão. Estudos de estabilidade mostraram que independentemente da concentração de LA, as formulações são mais estáveis em pHs mais altos, quando LA está em sua maioria na forma de laurato. Os experimentos de DSC revelaram que em pHs 3,0 e 5,0 e concentrações maiores de LA, a interação deste ácido graxo com as bicamadas é favorecida, havendo um aumento da temperatura de transição de fase (Tm) e diminuição da cooperatividade. Análises de taxa de incorporação de sondas hidrofílicas confirmaram a presença de um compartimento aquoso interno para as vesículas de DPPC:LA. O LA conseguiu permear a pele no período avaliado e pouco LA foi liberado das vesículas em condições de temperatura ambiente. A morfologia das LUV se mostrou bem diferente da esperada e se observaram vesículas com mais de uma bicamada e outros formatos que não o esférico. Estes resultados podem auxiliar na otimização das condições para uma formulação que poderá ser usada no tratamento da acne, aumentando a eficácia do LA no sítio alvo.

Relevância:

80.00% 80.00%

Publicador:

Resumo:

O objetivo do presente estudo foi verificação da viabilidade da aplicação de gelatina de pés de frango em spread de chocolate como substituto parcial de gordura. Inicialmente apresentou-se uma revisão de literatura sobre os principais aspectos que envolvem a pesquisa. Após relatou-se a metodologia de extração e caracterização físico-química da gelatina obtida de pés de frango por meio de análises de composição centesimal, de cor, força de gel e análise de perfil de textura (TPA). Posteriormente abordou-se os efeitos da aplicação de gelatina como substituto de gordura nas propriedades físico-químicas e reológicas de spread de chocolate. Por último investigou-se a influência da concentração de gelatina e substituição de gordura na espalhabilidade, estabilidade (shelf life), custos e propriedades sensoriais dos spreads de chocolate. Para tanto, foi utilizado planejamento experimental Central Composto Rotacional e metodologia de superfície de resposta. Os resultados da extração de gelatina de subproduto de frango indicaram que as peles e tendões dos pés de frango possuem rendimento (7,83 %) e conteúdo mineral (1,92 %), apresentando alto teor proteico (84,96 %) próximo das gelatinas comerciais. Em concentração de 6,67 % a gelatina demonstrou elevada força de gel (294,78 g), comportando-se na análise de perfil de textura como um sólido. Os dados relacionados às formulações de spread de chocolate demonstraram que tanto o nível de substituição de gordura quanto a concentração de gelatina exerceram efeitos significativos (p<0,05) sobre a cor, volume, densidade e comportamento reológico dos produtos, exceto a atividade de água que foi influenciada apenas pelo primeiro fator. Sob a perspectiva reológica apenas a amostra com maior nível de substituição de gordura foi classificada como pseudoplástica. A gelatina contribuiu no aumento do teor proteico das formulações. A consistência foi significativamente (p<0,05) influenciada pelas propriedades da fase de gelatina, apresentando ampla faixa de plasticidade nas diferentes temperaturas (10, 20 e 30 °C). A consistência dos spreads aumentou em todas as temperaturas durante os 90 dias de armazenamento. Observou-se por meio da análise sensorial que os fatores em estudo provocaram alterações nos atributos sensoriais do produto suficiente para a percepção dos provadores. A formulação com 75 % de substituição de gordura seguida pelas formulações com 50 % e 0,8 % de concentração de gelatina apresentaram a maior aceitabilidade. Com o máximo de substituição de gordura chegou-se a 53 % de redução de custos. Contudo, os resultados obtidos sugerem que a aplicação de gelatina de pés de frango pode ser vantajosa, já que contribuiu com a formulação de spreads de chocolate menos calóricos e com propriedades físico-químicas e sensoriais adequadas para uma possível comercialização.