955 resultados para Drug toxicity


Relevância:

20.00% 20.00%

Publicador:

Resumo:

Following a static bioassay techniques the acute toxicity of cadmium to six species of intertidal invertebrates was determined. The sensitivity of the animals to cadmium was of the following order: Emerita sp. (burrowing crustacean) Donax spiculum (burrowing bivalve) Perna viridis (sedentary bivalve) Sabellaria clandestinus (tube-dwelling polychaete) Modiolus carvalhoi and Modiolus sp. (sedentary bivalves). The above observation was based on the median lethal concentrations recorded for the different species, Emerita sp. 1.35 p.p.m., Donax spiculum 1.8 p.p.m., Perna viridis 2.5 p.p.m., Sabellaria clandestinus 2.8 p.p.m., Modiolus carvalhoi 5.6 p.p.m. and Modiolus sp. 9.6 p.p.m. The findings throw insight into the toxicity of cadmium to the common intertidal animals which are either suspension or detritus feeders.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

96h acute toxicity tests were performed using commercial grade metasystox on the marine wedge clam, Donax cuneatus during summer 1985. The behaviour and mortality rates were recorded periodically. Most of the dams responded in opening the shell valves and extending the siphons quicker in low test concentrations (0.004-0.0052 p.p.m) but this was slow and late in high concentrations (0.0056-0.008 p.p.m). Mortality began to occur in 0.008 p.p.m. from 12 h, whereas, in 0.0052 p.p.m. from 60 h onwards. The observed LC sub(0) value was 0.004 p.p.m. and LC sub(50) 0.0064 p.p.m. The regression equation established was Y = 79.0891 + 33.4523 X. The rate of oxygen concentration increased at LC sub(0) and LC sub(50) values compared to control indicating the disturbed physiological adjustment. The results are correlated with physico-chemical parameters of seawater and discussed in the light of pesticide toxicity to the dam.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Toxicity of inorganic mercury to different life history stages of fresh water fishes, Cyprinus carpio and Cirrhinus mrigala were demonstrated by static bioassays. 48 and 94% of egg hatching occurred in controls at 72 and 24h of experimentation in C. carpio and C. mrigala respectively. While fish eggs in water containing mercuric chloride showed delayed development as compared to the control. LC50, LC100 and safe concentrations of hatchling, fry and fingerling were calculated. Hatchling and fry were observed to be more susceptible as compared to fingerlings of C. carpio and C. mrigala.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

A study was undertaken examining the effect of malachite green on the development and survival of the zoeae, mysis and post-larvae of Penaeus monodon. Sensitivity varied with the different larval stages; the zoeae appeared to be the least tolerant. The prophylactic potentials of malachite green in the control of Lagenidiumand Zoothamnium infesting P. monodon larvae are considered briefly. Toxicity risks may be reduced by application between ecdyses or by the removal of the dye by filtration through activated carbon.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

The acute toxicity of un-ionized ammonia to milkfish (Chanos chanos) fingerlings was determined using a static bioassay system. Median lethal concentrations found show that milkfish fingerlings have a high tolerance to ammonia and it is unlikely that levels as high as those employed for the acute exposure would be found to occur under natural conditions. Although the threat of acute toxicological effects induced by ammonia are remote, such conditions might be encountered in stressed natural environments or in heavily loaded aquaculture systems.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

The study was conducted to determine the effects of varying concentrations of ammonia to milkfish fry. Two runs of static 96h bioassays were conducted to determine the median lethal concentration (LC 50) of unionized ammonia (NH3) to milkfish fry. Test concentrations were based on exploratory 24h and 48h bioassays and were made in three replicates. Reagent grade ammonium chloride (NH4Cl) was used to adjust the level of unionized ammonia. The 96h median lethal concentration, determined by the Reed Muench method was calculated at 28.029 ppm NH3 29.69 ppm. Even at high concentrations of unionized ammonia, most of the fry mortality occurred after 48 to 96 hours exposure. Severe gill damage occurs only at concentrations above 20 ppm, especially above the LC 50. The high LC 50 value obtain shows that milkfish fry has great tolerance to ammonia, that even fry with severely-damaged gills can still recover days after it is returned to favorable culture condition. The result suggest that observed mortalities of milkfish fry under culture conditions are not due to ammonia toxicity.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

BACKGROUND: Drug resistance profiles of human immunodeficiency virus-1 (HIV-1) in treatment-naive infections have been reported in developed countries. However, little is known in developing countries, including China, especially in treatment-naive volunt

Relevância:

20.00% 20.00%

Publicador:

Resumo:

In one of our recent studies, two HCV genotype 6 variants were identified in patients from Hong Kong and Guangxi in southern China, with injection drug use and HIV-1 co-infection. We report the complete genomic sequences for these two variants: GX004 and

Relevância:

20.00% 20.00%

Publicador:

Resumo:

The research was conducted to determine the toxicity of extracts from five Philippine species of marine sponges on tilapia Oreochromis niloticus fry. It was found out that the most potent was the methanol extract of Dysidea herbacea, it kills with the least toxin and at the shortest time.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

To explore the possible abnormal resting-state activity in patients with obsessive-compulsive disorder (OCD), the regional homogeneity (ReHo) of 22 pairs of patients and well-matched healthy controls was calculated. Compared with controls, the patients showed higher ReHo in the left anterior cingulate cortex, but lower ReHo in the left inferior temporal gyrus. These findings supported the abnormal resting-state brain activity in drug-naive OCD patients. No significant correlations between ReHo value and four clinical characteristics were found, suggesting that abnormal ReHo might be trait-related in OCD. NeuroReport 21:786-790 (C) 2010 Wolters Kluwer Health vertical bar Lippincott Williams & Wilkins.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Economical achievement of optimal growth in developing countries may lead to sustainable poverty reduction. Agricultural activities play an important role in economy and human being welfare, which leads to establishment of food security and quality. Aquaculture products in developing countries share 51.4 percent of total agricultural production.7—percent in developed countries. Therefore undoutedly food production by means of quality and quantity has to be increased .The history of shirmp production goes back to 500 years ago. Today 50 countries of the world produce shirmp .In Islamic Republic of Iran shrimp production started since 1992 in the coastal region of Persian Gulf. The shrimp culture farms canbe classified in to 4 different categories; Extensive, semi-extensive, intensive and super instensive. Global ecological manitenanc is one of the major concerns of authorities Human manipulation of nature is the most destructive activity. Industrial sweage leakage in to the rivers and water sources is a big issue that causes reduction in the aquatic population. Heavy metals have an inhibitory effect in the production and growth of sealife. Human intake of food treated with anti microbial cause's allergy, hypersensitivity and develops microbial resistance. Organochlorine compounds contamination may found in hepato pancreatic tissues of aquatic products, Aresnic may transfer to man via plant & animal product contamination. In 1991 during Persian Gulf Mir 700 oil well set

Relevância:

20.00% 20.00%

Publicador:

Resumo:

The toxicities of four insecticides and a herbicide to Tilapia macrochir were tested in the laboratory. The 24 hour LC50's were estimated as follows: Endrin 20% ,0.008 ppm; Lindane 5% granules, 4.6 ppmm; Synexa 50 (HCH) 50%), 5.6 ppm; Synex 25 (HCH 25%), 14.8 ppm; TOK herbicide (Nitrofen), 100% survival for 24 hours at 100 ppm. These estimates agree with results obtained by other workers elsewhere in the world. The laboratory determination of toxicity is important in estimating the direct effects of poisonous substances on fish, but other indirect effects may result from their use. These should be investigated in the field.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

The southeastern region of Yunnan province is a key site for drug trafficking and HIV-1 infection spread from the west of Yunnan and Laos to southeastern China. To investigate the prevalence of HIV-1 infection and hepatitis C virus (HCV) coinfection among injection drug users (IDUs) in southeastern Yunnan, three cohorts of 285 addicts, including 242 IDUs and 43 oral drug users, living in the cities of Gejiu and Kaiyuan and the county of Yanshan were studied. HIV-1 and HCV infections were detected by enzyme-linked immunosorbent assay and/or polymerase chain reaction. Data on the age, sex, risk behavior, drug use history, employment, ethnic background, and marriage status were obtained by interview. The overall prevalence of HIV-1 infection was 71.9%. The rate of HCV coinfection among 138 HIV-1-infected IDUs was 99.3%. Most HIV-infected IDUs were 20 to 35 years old (86.7%) and were ethnic Han (75.9%), suggesting that the epidemic in Yunnan is no longer confined to non-Han ethnic minorities, HIV prevalence in female IDUs (81.2%) was significantly higher than in male IDUs (68.2%) (p <.05). The prevalence of HIV infection reached 68.4% after 1 year of injection drug use. Needle/syringe sharing is the major high risk factor for the spread of HIV-1 and HCV infections. Large-scale educational campaigns are urgently needed to reduce the spread of HIV and HCV infection in these regions.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

The recent re-emergence of tuberculosis, especially the multidrug-resistant cases, has highlighted the importance of screening effective novel drugs against Mycobacterium tuberculosis. In this study, the in vitro activities of small peptides isolated from snake venom were investigated against multidrug-resistant M. tuberculosis. Minimum inhibitory concentrations (MICs) were determined by the Bactec TB-460 radiometric method. A small peptide with the amino acid sequence ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG (designated as vgf-1) from Naja atra (isolated from Yunnan province of China) venom had in vitro activity against clinically isolated multidrug-resistant strains of M. tuberculosis. The MIC was 8.5 mg/l. The antimycobacterial domain of this 60aa peptide is under investigation. (C) 2003 Elsevier Science B.V. and the International Society of Chemotherapy. All rights reserved.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Hexabromocyclododecane (HBCD) is widely used as a brominated flame retardant, and has been detected in the aquatic environment, wild animals, and humans. However, details of the environmental health risk of HBCD are not well known. In this study, zebrafish embryos were used to assess the developmental toxicity of the chemical. Four-hour post-fertilization (hpf) zebrafish embryos were exposed to various concentrations of HBCD (0, 0.05, 0.1, 0.5, and 1.0 mg L-1) until 96 h. Exposure to 0.1, 0.5, and 1.0 mg L-1 HBCD significantly increased the malformation rate and reduced survival in the 0.5 and 1.0 mg L-1 HBCD exposure groups. Acridine orange (AO) staining showed that HBCD exposure resulted in cell apoptosis. Reactive oxygen species (ROS) was significantly induced at exposures of 0.1, 0.5, and 1.0 mg L-1 HBCD. To test the apoptotic pathway, several genes related to cell apoptosis, such as p53, Puma, Apaf-1, caspase-9, and caspase-3, were examined using real-time PCR. The expression patterns of these genes were up-regulated to some extent. Two anti-apoptotic genes, Mdm2 (antagonist of p53) and Bcl-2 (inhibitor of Bax), were down-regulated, and the activity of capspase-9 and caspase-3 was significantly increased. The overall results demonstrate that waterborne HBCD is able to produce oxidative stress and induce apoptosis through the involvement of caspases in zebrafish embryos. The results also indicate that zebrafish embryos can serve as a reliable model for the developmental toxicity of HBCD. (C) 2009 Elsevier B.V. All rights reserved.