Efecto de fertilización orgánica y fertilización sintética en el crecimiento y rendimiento del pipian (Cucurbita argyrosperma, Huber), Finca El Plantel, Masaya, 2007

El presente estudio se estableció en el mes de junio del 2007 en la finca El Plantel, propiedad de la Universidad Nacional Agraria, ubicada en el km 42 de la carretera Tipitapa-Masaya, con el objetivo de evaluar el efecto de fertilización orgánica y fertilización sintética en el crecimiento y rendimiento del cultivo de pipian ( Cucurbita argyrosperma Huber). Como hipótesis nula se planteó que la fertilización orgánica en la producción de pipián no presentan diferencias estadísticas significativas en el crecimiento y rendimiento, en comparació n con la fertilización sintética. Se utilizó un diseño de parcelas apareadas, en el cual se establecieron dos tratamientos uno convencional aplicando fertilizantes sintéticos, urea y completo; y orgánico proporcionando al suelo compost, humus de lombriz y biofertilizante líquido. Las variables evaluadas fueron: número de hojas verdaderas, amplitud vegetativa, número de frutos por planta, longitud del fruto, diámetro del fruto, peso del fruto, todas estas variables fueron sometidas al análisis de la t de student. Se encontró diferencias estadísticas significativas únicamente para la variable número de hojas. Se concluye que el efecto de los tratamientos con fertilización orgánica no manifiesta su efecto en este primer ciclo, por lo que tienen que pasar por un proceso de estabilización del agrosistema

Efecto del manejo orgánico y convencional sobre la dinámica poblacional de arvenses en el cultivo de pipian (Cucurbita argyrosperma Huber) Tipitapa, Masaya, 2009

En la finca El Plantel, propiedad de la Universidad Nacional Agraria año 2009, se estudió el efecto de dos manejos, orgánico y convencional sobre la dinámica poblacional de arvenses en el cultivo de pipián, con el fin de contribuir con técnicas de manejo de arvenses en la producción de este cultivo en las áreas de la pequeña y mediana producción. Se estableció en un diseño de parcelas apareadas con dos tratamientos y cuatro repeticiones, cada parcela de 84 m². En el tratamiento orgánico se aplicó Compost en dosis de 5618 Kg.ha-1, humus de lombriz a razón de 2519.04 kg.ha-1 y biofertilizantes líquidos en dosis de 1,345 l. ha-1. En el tratamiento convencional, fertilizante completo de la fórmula 12-30-10 a razón de 161.90 kg.ha-1 y urea 46% a razón de 307.5 kg.ha-1. Se evaluó: Composición florística de arvenses, Biomasa acumulada por familia y especies, Cobertura de arvenses en porcentaje, Banco de semillas de arvenses y el rendimiento del cultivo en kg/ha. Este último se analizó mediante la prueba de t student y las variables de arvenses por el análisis descriptivo, para ello el uso de promedios y graficas. La mayor diversidad de especie se encontró en el sistema orgánico (18 especies) en comparación con el sistema convencional (16 especies). La diversidad y abundancia se vio representada por las especies Cyperus rotundus L., Ixophorus unicetus L. y Sorghum halapense (L.) Pers. Sida acuta. F, Cleome viscosa L. La mayor biomasa se registro el sistema orgánico (5462.5 g), con el mayor peso las familias Poaceae (2840.6 g), Amaranthaceae (863.5 g) y Nyctaginaceae (668.2 g), en comparación con el convencional (3764.5 g) donde las Poaceae (1579 g) y Nyctaginaceae (902.2 g) con el mayor peso. El porcentaje de cobertura de arvenses en el sistema orgánico superó al porcentaje de cobertura del sistema convencional, presentando la mayor diversidad y la menor abundancia de especie. La diversidad en el banco de semilla en condiciones de invernadero difiere a lo encontrado en campo. Encontrándose una diversidad de 14 especies, Ixophorus unicetus L. y Sida acuta Burm F, son las especies de mayor presencia en ambos sistemas. El rendimiento (kg.ha-1), no presentó diferencias estadísticamente significativas (p=0.2894).

Evaluacion de bicarbonato de sodio, caldo vizosa y caldo bordeles en el control de la cenicilla (Erysiphe cichoracearum DC) en el cultivo de pipian (Cucurbita pepo L.), en Apacunca, Chinandega

El pipián ( Cucurbita pepo.) tiene su origen en el continente americano, por lo que la diversidad genética presente en el continente ha permitido muchas denominaciones populares. El trabajo de investigación se llevó a cabo en la Reserva de Recursos Genéticos de Apacunca, en la comunidad de Asquespalapa, el objetivo fue encontrar opciones de bajo costo y no dañinas a la salud humana y ambiente, para el control de la Cenicilla del Pipián ( Erysiphe cichoracearum), Los tratamientos fueron arreglados en un diseño de bloque completo al azar (B.C.A) con tres réplicas. El ensayo fue establecido en una Area de 100m2. Cada parcela experimental estuvo constituida por 4 surcos de 6 metros de largo con distancia entre plantas de 1 metro. El área total de cada parcela experimental fue de 18 metros cuadrados. La parcela útil estuvo constituida por las 8 plantas centrales de cada parcela experimental. La variedad utilizada para el estudio fue la Criolla. Los tratamientos probados consistieron en tres caldos minerales preventivos y un testigo, se realizó un análisis de varianza con un 95 % de confianza y separación de medias según Tukey LSD (∞= 0.05) y análisis de beneficio costo. Los resultados indican que el caldo vizosa mostró únicamente entre un 5 y 10% de afectación en cuanto a la incidencia y severidad de la enfermedad, en segunda categoría encontramos al caldo bordelés con un 15 y 20 %, de afectación. En cuanto a la relación beneficio costo se determinó que el caldo Vizosa es un producto rentable ad amas de mantener la parcela libre de patógenos da un resultado económico en cuanto a la producción y compensación a la hora de vender en el mercado.

Comparación de la incidencia poblacional de insectos plagas y benéficos en arreglos de monocultivo versus policultivos de tomate (Lycopersicum esculentum MILL,) Pipian (Cucurbita pepo L.) y frijol (Phaseolus vulgaris L.)

Con el objetivo de generar información técnica para los productores de Nicaragua se realizó un estudio donde se comparó el efecto que tiene la asociación de cultivos sobre la entomofauna benéfica y no-benéfica. El estudio se realizó en la finca, Jarrón Azul, ubicada en la comarca de Santa Rica Municipio de Niquinohomo departamento de Masaya. El estudio se realizó de Mayo a Octubre del 2005. Se seleccionó una finca representativa de un productor líder en donde se seleccionaron cuatro parcelas de 12x15m 2 cada una, las cuatro parcelas se dividieron en dos grupos, tres parcelas se sembraron con monocultivos (Fríjol, Tomate y Pipian) y una parcela se arregló en forma de policultivo (Fríjol, Tomate y Pipian). Para realizar los muestreos en cada parcela se tomaron al azar cinco estaciones, cada estación estaba compuesta por 10 plantas, en cada estación se tomaron semanalmente las variables: número de plantas por estación, plantas sanas, insectos plagas y benéficos por planta. Al finalizar este trabajo se comparò el total de insectos plagas y benéficos entre las parcelas de monocultivo versus policultivos, encontrándose que de manera general se observó una tendencia de mayor ocurrencia de insectos plagas en monocultivo que en policultivo y además se encontró una tendencia de mayor número de artrópodos benéficos en policultivo que en monocultivo. Las plagas más comunes encontradas en este estudio fueron moscas blancas, Diabrotica sp ., aphids, Diaphania, sp ., Melittia sp. y los benéficos encontrados fueron: arañas, hormigas y abejas

Efecto de cultivos en asocio pepino (Cucumis sativus L.), pipián (Cucurbita pepo L.) y frijol de vara (Vigna unguiculata L. Walp), en la ocurrencia poblacional de insectos plagas, benéficos y el rendimiento en Tisma, Masaya

El presente estudio se realizó con el objetivo de comparar el efecto que tiene el sistema en asocio de cultivos sobre la ocurrencia poblacional de insectos plagas, benéficos y el uso equivalente de la tierra. El estudio se estableció en la finca "Berlín", ubicada en el Municipio de Tisma - Masaya, en los meses de diciembre 2006 a febrero 2007. Para el desarrollo de esta investigación se establecieron cuatro parcelas, una parcela se sembró en arreglo de los cultivos (pepino, pipián y fríjol de vara) y tres parcelas se sembraron con los cultivos solos de pepino, pipián y fríjol de vara. En cada estación se tomaron semanalmente las siguientes variables: número de insectos plagas y benéficos por planta, y durante la cosecha, el rendimiento de cada cultivo para calcular el uso equivalente de la tierra (UET). En general se observó una tendencia de menor número de insectos plagas y mayor número de insectos benéficos en la parcela de los cultivos asociados en comparación con los cultivos solos, aunque no se encontró diferencias significativas entre los dos sistemas de cultivos. Se calculó el uso equivalente de la tierra (UET) y se encontró que el sistema en asocio (pepino, pipián y fríjol de vara) presentó el mejor aprovechamiento de la tierra al obtener rendimientos de 31, 40 y 11 % más de producción respectivamente que los cultivos solos, haciendo un mejor uso de la tierra por unidad de área.

A novel bradykinin-related peptide from skin secretions of toad Bombina maxima and its precursor containing six identical copies of the final product

Amphibian skin contains rich bradykinin-related peptides, but the mode of biosynthesis of these peptides is unknown. In the present study, a novel bradykinin-related peptide, termed bombinakinin M, was purified from skin secretions of the Chinese red bell

An anionic antimicrobial peptide from toad Bombina maxima

Amphibian skin is a rich resource of antimicrobial peptides like maximins and maximins H from toad Bombina maxima. A novel cDNA clone encoding a precursor protein that comprises maximin 3 and a novel peptide. named maximin H5. was isolated from a skin cDNA library of B. maxima. The predicted primary structure of maximin H5 is ILGPVLGLVSDTLDDVLGIL-NH2,. Containing three aspartate residues and no basic amino acid residues. maximin H5 is characterized by an anionic property. Different from cationic maximin H peptides. only Gram-positive strain Staphylococcus aureus was sensitive to maximin H5. while the other bacteria] and fungal strains tested ere resistant to it. The presence of metal ions. like Zn2+ and Mg2+, did not increase its antimicrobial potency. Maximin H5 represents the first example of potential anionic antimicrobial peptides from amphibians, The results provide the first evidence that. together kith cationic antimicrobial peptides. anionic antimicrobial peptides may also exist naturally as part of the innate defense system. (C), 2002 Elsevier Science (USA). All rights reserved.

Antimicrobial peptides from skin secretions of Chinese red belly toad Bombina maxima

Two groups of antimicrobial peptides have been isolated from skin secretions of Bombina maxima. Peptides in the first group, named maximins 1, 2, 3, 4 and 5, are structurally related to bombinin-like peptides (BLPs). Unlike BLPs, sequence variations in maximins occurred all through the molecules. In addition to the potent antimicrobial activity, cytotoxicity against tumor cells and spermicidal action of maximins, maximin 3 possessed a significant anti-HIV activity. Maximins 1 and 3 were toxic to mice with LD50 values of 8.2 and 4.3 mg/kg, respectively. Peptides in the second group, termed maximins H1, H2, H3 and H4, are homologous with bombinin H peptides. cDNA sequences revealed that one maximin peptide plus one maximin H peptide derived from a common larger protein. (C) 2002 Elsevier Science Inc. All rights reserved.

A novel proline rich bombesin-related peptide (PR-bombesin) from toad Bombina maxima

A novel bombesin-related peptide was isolated from skin secretions of Chinese red belly toad Bombina maxima. Its primary structure was established as pGlu-Lys-Lys-Pro-Pro-Arg-Pro-Pro-Gln-Trp-Ala-Val-Gly-His-Phe-Met-NH2. The amino-terminal (N-terminal) 8-residue segment comprising four prolines and three basic residues is extensively different from bombesins from other Bombina species. The peptide was thus named proline rich bombesin (PR-bombesin). PR-bumbesin was found to elicit concentration-dependent contractile effects in the rat stomach strip, with both increased potency and intrinsic activity as compared with those of [Leu(13)]bombesin. Analysis of different bombesin cDNA structures revealed that an 8 to 14- nucleotide fragment replacement in the peptide coding region (TGGGGAAT in the cDNAs of multiple bombesin forms from Bombina orientalis and CACCCCGGCCACCC in the cDNA of PR-bombesin) resulted in an unusual Pro-Pro-Arg-Pro-Pro motif in the N-terminal part of PR-bombesin. (C) 2002 Elsevier Science Inc. All rights reserved.

Identification and cloning of a trypsin inhibitor from skin secretions of Chinese red-belly toad Bombina maxima

A novel trypsin inhibitor was identified and purified from skin secretions of Chinese red-belly toad Bombina maxima. The partial N-terminal 29 amino acid residues of the peptide, named BMTI, were determined by automated Edman degradation. This allowed the cloning of a full-length cDNA encoding BMTI from a cDNA library prepared from the toad skin. The deduced complete amino acid sequence of BMTI indicates that mature BMTI is composed of 60 amino acids. A FASTA search in the databanks revealed that BMTI exhibits 81.7% sequence identity with BSTI, a trypsin/thrombin inhibitor from European toad Bombina bombina skin secretions. Sequence differences between BMTI and BSTI were due to 11 substitutions at positions 2, 9, 25, 27, 36-37, 39, 41-42, 50 and 56. BMTI potently inhibited trypsin with a K-i value of 0.06 muM, similar to that of BSTI. However, unlike BSTI, which also inhibited thrombin with a K-i value of 1 muM, no inhibitory effect of BMTI on thrombin was observed under the assay conditions. (C) 2002 Elsevier Science Inc. All rights reserved.

Bombinakinin M gene associated peptide, a novel bioactive peptide from skin secretions of the toad Bombina maxima

A novel 28-amino acid peptide, termed bombinakinin-GAP, was purified and characterized from skin secretions of the toad Bombina maxima. Its primary structure was established as DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH2, in which two cysteines form a disulfide bond. A FASTA search of SWISS-PROT databank detected a 32% sequence identity between the sequences of the peptide and a segment of rat cocaine- and amphetamine-regulated transcript (CART). Intracerebroventricular (i.c.v.) administration of the peptide induced a significant decrease in food intake in rats, suggesting that it played a role in the control of feeding by brain. Analysis of its cDNA structure revealed that this peptide is coexpressed with bombinakinin M, a bradykinin-related peptide from the same toad. Bombinakinin-GAP appears to be the first example of a novel class of bioactive peptides from amphibian skin, which may be implicated in feeding behavior. (C) 2003 Elsevier Science Inc. All rights reserved.

Cloning of novel bombesin precursor cDNAs from skin of Bombina maxima

Amphibian skin is a rich resource of bioactive peptides like proline-rich bombesin from frog Bombina maxima. A novel cDNA clone encoding a precursor protein that comprises proline-rich bombesin and a novel peptide, designated as bombestatin, was isolated from a skin cDNA library of B. maxima. The predicted primary structure of the novel peptide is WEVLLNVALIRLELLSCRSSKDQDQKESCGMHSW, in which two cysteines form a disulfide bond. A BLAST search of databases did not detect sequences with significant similarity. Bombestatin possesses dose-dependent contractile activity on rat stomach strips. The differences between cDNAs encoding PR-bombesin plus bombestatin and PR-bombesin alone are due to fragment insertions located in 3'-coding region and 3'-untranslational region, respectively. (c) 2005 Elsevier B.V. All rights reserved.

Maximin 9, a novel free thiol containing antimicrobial peptide with antimycoplasma activity from frog Bombina maxima

Amphibian skin is a rich resource of antimicrobial peptides, like maximins and maximin Hs from frog Bombina maxima. Novel cDNA clones encoding a precursor protein, which comprises a novel maximin peptide (maximin 9) and reported maximin H3, were isolated from two constructed skin cDNA libraries of B. maxima. The predicted primary structure of maximin 9 is GIGRKFLGGVKTTFRCGVKDFASKHLY-NH2. A surprising substitution is at position 16, with a free cysteine in maximin 9 rather than usual conserved glycine in other reported maximins. Maximin 9, the homodimer form and its Cys(16) to Gly(16) mutant were synthesized and their antimicrobial activities were evaluated. Unlike previously reported maximin 3, the tested bacterial and fungal strains were resistant to maximin 9, its homodimer and the Cys(16) to Gly(16) mutant (with MICs > 100 mu M). On the other hand, interestingly, while eight clinical Mollicutes strains were generally resistant to maximin 9 homodimer and its Cys(16) to Gly(16) mutant, most of them are sensitive to maximin 9 at a peptide concentration of 30 mu M, especially in the presence of dithiothreitol. These results indicate that the presence of a reactive Cys residue in maximin 9 is important for its antimycoplasma activity. The diversity of antimicrobial peptide cDNA structures encountered in B. maxima skin cDNA libraries and the antimicrobial specificity differences of the peptides may reflect well the species' adaptation to the unique microbial environments. (c) 2005 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

Identification and molecular cloning of a novel neuromedin U analog from the skin secretions of toad Bombina maxima

Amphibian skin contains rich neuropeptides. In the present study, a novel neuromedin U (NmU) analog was isolated from skin secretions of Chinese red belly Load Bombina maxima. Being 17-amino acids long, its primary structure was established as DSSGIVGRPFFLFRPRN-NH2, in which the C-terminal 8-residue segment (FFLFRPRN) is the same as that of rat NmU, while the N-terminal part DSSGIVGRP shows a great sequence variation compared with those of NmU peptides from different resources. The peptide, named Bm-NmU-17, was found to elicit concentration-dependent contractile effects on smooth muscle of rat uterus horns. The cDNA Structure of the peptide, as obtained by a 3'-RACE strategy and subsequently cloning from a skin cDNA library, was found to contain a coding region of 438 nucleotides. The encoded precursor is composed of 145 amino acids with a single copy of Bm-NmU-17 located towards the C-terminus. The sequence of the peptide is preceded by a dibasic site (Lys-Arg) and followed by the sequence of Gly-Arg-Lys, providing the sites of cleavage and releasing of the mature peptide. (c) 2005 Elsevier B.V. All rights reserved.

Bm-TFF2, a trefoil factor protein with platelet activation activity from frog Bombina maxima skin secretions

In mammals, trefoil factor family (TFF) proteins are involved in mucosal maintenance and repair, and they are also implicated in tumor suppression and cancer progression. A novel two domain TFF protein from frog Bombina maxima skin secretions (Bm-TFF2) has been purified and cloned. It activated human platelets in a dose-dependent manner and activation of integrin a(11b)beta(3) was involved. Aspirin and apyrase did not largely reduce platelet response to Bm-TFF2 (a 30% inhibition), indicating that the aggregation is not substantially dependent on ADP and thromboxane A2 autocrine feedback. Elimination of external Ca2+ with EGTA did not influence the platelet aggregation induced by Bm-TFF2, meanwhile a strong calcium signal (cytoplasmic Ca2+ release) was detected, suggesting that activation of phospholipase C (PLC) is involved. Subsequent immunoblotting revealed that, unlike in platelets activated by stejnulxin (a glycoprotein VI agonist), PLC gamma 2 was not phosphorylated in platelets activated by Bm-TFF2. FITC-labeled Bm-TFF2 bound to platelet membranes. Bm-TFF2 is the first TFF protein reported to possess human platelet activation activity. (c) 2005 Elsevier Inc. All rights reserved.