968 resultados para 291801 Fluidization and Fluid Mechanics
Resumo:
The main effects on the dynamics of a liquid bridge due to the presence of an outer liquid, as occur in experiments using the Plateau-tank technique, are considered. The one-dimensional nonlinear model developed here allows us to perform the computation of both breaking processes and oscillatory motions of slender liquid bridges, although in this paper only the results concerning breaking processes are reported. Additionally,the oscillatory motions are studied both experimentally and by using a new linear model. Results from both sources show good agreement
Resumo:
If only Fluid Mechanics aspects are considered, the configuration appearing in the floating zone technique for crystal growth can be modelled as a mass of liquid spanning between two solid rods. Besides, if now the influence of temperature gradients and heat flow are not considered, the simplest fluid model consists of an isothermal liquid mass of constant properties (density and surface tension) held by capillary forces between two solid disks placed a distance L apart: the so called liquid bridge. As it is well known, if both supporting disks were parallel, coaxial and of the same diameter, 2R, the volume of liquid, V, were equal to that of a cylinder of the same L and R (V=KR~L) and no body forces were acting on the liquid column, the fluid configuration (under these conditions of cylindrical shape) will become unstable when the distance between the disks equals the length of the circumference of the supporting disks (L=2KR, the so-called Rayleigh stability limit). One should be aware that the Rayleigh stability limit can be dramatically modified when the geometry differs from the above described cylinder (due to having non-coaxial disks, different diameter disks, liquid volume different from the cylindrical one, etc) or when other external effects like accelerations either axial or lateral are considered. In this paper the stability limits of liquid bridges considering different types of perturbations are reviewed.
Resumo:
Supporting data are included in PDF and CSV files; any additional data may be obtained from the corresponding author (e-mail: j.vinogradov@imperial.ac.uk). TOTAL is thanked for partial support of Jackson's Chair in Geological Fluid Mechanics and for supporting the activities of the TOTAL Laboratory for Reservoir Physics at Imperial College London where these experiments were conducted. The Editor thanks Andre Revil and Paul Glover for their assistance in evaluating this paper.
Resumo:
In polarized HepG2 hepatoma cells, sphingolipids are transported to the apical, bile canalicular membrane by two different transport routes, as revealed with fluorescently tagged sphingolipid analogs. One route involves direct, transcytosis-independent transport of Golgi-derived glucosylceramide and sphingomyelin, whereas the other involves basolateral to apical transcytosis of both sphingolipids. We show that these distinct routes display a different sensitivity toward nocodazole and cytochalasin D, implying a specific transport dependence on either microtubules or actin filaments, respectively. Thus, nocodazole strongly inhibited the direct route, whereas sphingolipid transport by transcytosis was hardly affected. Moreover, nocodazole blocked “hyperpolarization,” i.e., the enlargement of the apical membrane surface, which is induced by treating cells with dibutyryl-cAMP. By contrast, the transcytotic route but not the direct route was inhibited by cytochalasin D. The actin-dependent step during transcytotic lipid transport probably occurs at an early endocytic event at the basolateral plasma membrane, because total lipid uptake and fluid phase endocytosis of horseradish peroxidase from this membrane were inhibited by cytochalasin D as well. In summary, the results show that the two sphingolipid transport pathways to the apical membrane must have a different requirement for cytoskeletal elements.
Resumo:
Paleontological data for the diversity of marine animals and land plants are shown to correlate significantly with a concurrent measure of stable carbon isotope fractionation for approximately the last 400 million years. The correlations can be deduced from the assumption that increasing plant diversity led to increasing chemical weathering of rocks and therefore an increasing flux of carbon from the atmosphere to rocks, and nutrients from the continents to the oceans. The CO2 concentration dependence of photosynthetic carbon isotope fractionation then indicates that the diversification of land plants led to decreasing CO2 levels, while the diversification of marine animals derived from increasing nutrient availability. Under the explicit assumption that global biodiversity grows with global biomass, the conservation of carbon shows that the long-term fluctuations of CO2 levels were dominated by complementary changes in the biological and fluid reservoirs of carbon, while the much larger geological reservoir remained relatively constant in size. As a consequence, the paleontological record of biodiversity provides an indirect estimate of the fluctuations of ancient CO2 levels.
Resumo:
Cytotoxic T cells recognize mosaic structures consisting of target peptides embedded within self-major histocompatibility complex (MHC) class I molecules. This structure has been described in great detail for several peptide-MHC complexes. In contrast, how T-cell receptors recognize peptide-MHC complexes have been less well characterized. We have used a complete set of singly substituted analogs of a mouse MHC class I, Kk-restricted peptide, influenza hemagglutinin (Ha)255-262, to address the binding specificity of this MHC molecule. Using the same peptide-MHC complexes we determined the fine specificity of two Ha255-262-specific, Kk-restricted T cells, and of a unique antibody, pSAN, specific for the same peptide-MHC complex. Independently, a model of the Ha255-262-Kk complex was generated through homology modeling and molecular mechanics refinement. The functional data and the model corroborated each other showing that peptide residues 1, 3, 4, 6, and 7 were exposed on the MHC surface and recognized by the T cells. Thus, the majority, and perhaps all, of the side chains of the non-primary anchor residues may be available for T-cell recognition, and contribute to the stringent specificity of T cells. A striking similarity between the specificity of the T cells and that of the pSAN antibody was found and most of the peptide residues, which could be recognized by the T cells, could also be recognized by the antibody.
Resumo:
Cholecystokinin (CCK) secretion in rats and humans is inhibited by pancreatic proteases and bile acids in the intestine. It has been hypothesized that the inhibition of CCK release caused by pancreatic proteases is due to proteolytic inactivation of a CCK-releasing peptide present in intestinal secretion. To purify the putative luminal CCK-releasing factor (LCRF), intestinal secretions were collected by perfusing a modified Thiry-Vella fistula of jejunum in conscious rats. From these secretions, the peptide was concentrated by ultrafiltration followed by low-pressure reverse-phase chromatography and purified by reverse-phase high-pressure liquid chromatography. Purity was confirmed by high-performance capillary electrophoresis. Fractions were assayed for CCK-releasing activity by their ability to stimulate pancreatic protein secretion when infused into the proximal small intestine of conscious rats. Partially purified fractions strongly stimulated both pancreatic secretion and CCK release while CCK receptor blockade abolished the pancreatic response. Amino acid analysis and mass spectral analysis showed that the purified peptide is composed of 70-75 amino acid residues and has a mass of 8136 Da. Microsequence analysis of LCRF yielded an amino acid sequence for 41 residues as follows: STFWAYQPDGDNDPTDYQKYEHTSSPSQLLAPGDYPCVIEV. When infused intraduodenally, the purified peptide stimulated pancreatic protein and fluid secretion in a dose-related manner in conscious rats and significantly elevated plasma CCK levels. Immunoaffinity chromatography using antisera raised to synthetic LCRF-(1-6) abolished the CCK releasing activity of intestinal secretions. These studies demonstrate, to our knowledge, the first chemical characterization of a luminally secreted enteric peptide functioning as an intraluminal regulator of intestinal hormone release.
Resumo:
O fenômeno de vibração induzida por vórtices (VIV) é um problema fundamental dentro da Mecânica dos Fluidos e um exemplo importante de interação fluido-estrutura. Esta tese investiga fenômeno de VIV quando um cilindro rígido, submetido a escoamento uniforme, está livre para oscilar na direção transversal e alinhada com a corrente incidente. A tese foi estruturada ao redor de sete perguntas relacionadas ao fenômeno de VIV: 1) O fenômeno e os resultados experimentais são repetitivos? 2) Como ocorre a transição entre ramos de resposta? 3) Qual é o papel da inércia da estrutura oscilante? 4) Qual é o papel de sua rigidez? 5) Quais são as frequências naturais mais importantes da estrutura? 6) Quais padrões de esteira se desenvolvem para VIV com dois graus de liberdade? 7) Quais são os efeitos do movimento na direção alinhada com a corrente no processo de formação e desprendimento de vórtices? O fenômeno de VIV é estudado de maneira experimental em uma base elástica pendular capaz de oscilar com o mesmo momento de inércia e frequência natural nas duas direções. Os experimentos de VIV foram realizados em canal de água recirculante e com diferentes condições de inércia e rigidez. A técnica de velocimetria por imagem de partículas foi usada e permitiu identificar diferentes padrões de esteira de vórtices. Verificou-se que o VIV é repetitivo a nível de amplitudes médias e frequências dominantes. A transição dos ramos pode ocorrer de maneira intermitente ou com histerese. Os parâmetros de inércia e rigidez da estrutura são capazes de mudar o regime de oscilação e, para algumas condições, suprimir as vibrações alinhadas com a corrente. Dentre os padrões de esteira observados, um deles não havia sido relatado na literatura e é definido nesta tese. O novo modo de emissão apresenta dois vórtices com circulação oposta e elevada intensidade emitidos por ciclo. A influência da direção alinhada com o escoamento está relacionada a dois efeitos: a velocidade relativa entre o cilindro e o fluido, responsável pelo aumento da circulação dos vórtices na esteira, e o ângulo de fase do movimento nas direções alinhada e transversal, capaz de mudar o processo de formação dos vórtices.
Resumo:
Este trabalho apresenta uma discussão sobre o estudo dos efeitos térmicos e elásticos decorrentes da pressão de sustentação presentes nos mancais. Para tanto, propõe-se um modelo matemático baseado nas equações para mancais curtos considerando a região de cavitação e utilizando o princípio da continuidade de massa. Com isto, deduzem-se as equações para o mancal a partir das equações de Reynolds e da energia, aplicando uma solução modificada para a solução de Ocvirk, sendo as equações resolvidas numericamente pelo Método das Diferenças Finitas. Somado o tratamento de mecânica dos fluidos, o trabalho discute dois modelos térmicos de previsão de temperatura média do fluido e sua influência no campo de pressão, apresentando gráficos representativos do campo de pressão e de temperatura, assim como as diferenças e implicações das diferenças. Para o cálculo de deformação da estrutura, utiliza-se um Modelo de Elementos Finitos para uma dada geometria, fazendo-se uma avaliação da variação do campo de pressão e o quanto essa diferença afeta as demais propriedades do fluido. Por fim, com o modelo completo, calcula-se o quanto esse modelamento para mancais curtos se aproxima de soluções para mancais finitos, com base em resultados da literatura, chegando a desvios quase oito vezes menores que os previstos pela literatura. Além disso, pode-se estabelecer a abrangência do modelo, ou seja, prever as condições em que suas propriedades são válidas e podem ser utilizadas para estudos iniciais.
Resumo:
The Surface Renewal Theory (SRT) is one of the most unfamiliar models in order to characterize fluid-fluid and fluid-fluid-solid reactions, which are of considerable industrial and academicals importance. In the present work, an approach to the resolution of the SRT model by numerical methods is presented, enabling the visualization of the influence of different variables which control the heterogeneous overall process. Its use in a classroom allowed the students to reach a great understanding of the process.
Resumo:
Pore fluid and sediment Li concentrations and isotopic ratios provide important insights on the hydrology, sediment contribution to the arc volcanoes and fluid-sediment reactions at the dominantly non-accretionary Costa Rica subduction zone. Ocean Drilling Program Site 1039 in the trench axis provides a reference section of 400 m of the incoming sediments, and Site 1040, situated arcward from the trench, consists of a deformed sedimentary wedge and apron sediments, the décollement, and the partially dewatered underthrust sediment section. At the reference site, pore fluids show important isotopic variations (delta6Li=-21.7 to -37.8 per mil), reflecting the interplay of in situ alteration of volcanic material and ion exchange with clay minerals. In the basal section, a reversal of Li concentration and delta6Li toward seawater values is observed, providing supporting evidence for a lateral seawater flow system in the upper oceanic basement underlying this sediment section. At Site 1040, pore fluid of the lower deformed wedge sediments and within the décollement is enriched in Li and the isotopic compositions are relatively light, suggesting infiltration of a deep-seated fluid. The delta6Li value of -22 per mil of this Li-enriched fluid (261 µM), when compared with the delta6Li value of the subducted sediment section (-11 per mil), suggests that the deep source fluid originates from mineral fluid dehydration and transformation reactions at temperatures of 100 to 150°C, consistent with the temperature range of the up-dip seismogenic zone and of transformation of smectite to illite. The distribution of Li and its isotopes in the underthrust section are similar to those at the reference site, indicating near complete subduction of the incoming sediments and that early dewatering of the underthrust sediments occurs predominantly by lateral flow into the ocean. The hemipelagic clay-rich sediment section of the subducting plate carries most of the Li into this subduction zone, and the pelagic diatomaceous and nannofossil calcareous oozes contain little Li. The Li isotopes of both the clay-rich hemipelagic sediments and of the pelagic oozes are, however, similar, with delta6Li values of -9 to -12 per mil. The observations that (1) the delta6Li values of the underthrust sediments are distinctly lower than that of the mantle, and (2) the lavas of the Costa Rican volcanoes are enriched in Li and 7Li, provide an approximation of the contribution of the subducted sediments to the arc volcanoes. A first order mass balance calculation suggests that approximately half of the Li flux delivered by subducted sediments and altered oceanic crust into the Middle American Trench is recycled to the Costa Rican arc and at most a quarter of sedimentary Li is returned into the ocean through thrust faults, primarily the décollement thrust.
Resumo:
Ocean Drilling Program Legs 170 and 205 offshore Costa Rica provide structural observations which support a new model for the geometry and deformation response to the seismic cycle of the frontal sedimentary prism and decollement. The model is based on drillcore, thin section, and electron microscope observations. The decollement damage zone is a few tens of meters in width, it develops mainly within the frontal prism. A clear cm-thick fault core is observed 1.6 km from the trench. The lower boundary of the fault core is coincident with the lithological boundary between the frontal prism and the hemipelagic and pelagic sediment of the Cocos plate. Breccia clast distributions in the upper portion of the decollement damage zone were studied through fractal analysis. This analysis shows that the fractal dimension changes with brecciated fragment size, implying that deformation was not accommodated by self-similar fracturing. A higher fractal dimensionality correlates with smaller particle size, which indicates that different or additional grain-size reduction processes operated during shearing. The co-existence of two distinct fracturing processes is also confirmed by microscopic analysis in which extension fracturing in the upper part of the damage zone farthest from the fault core is frequent, while both extension and shear fracturing occur approaching the fault core. The coexistence of extensional and shear fracturing seems to be best explained by fluid pressure variations in response to variations of the compressional regime during the seismic cycle. During the co-seismic event, sub-horizontal compression and fluid pressure increase, triggering shear fracturing and fluid expulsion. Fractures migrate upward with fluids, contributing to the asymmetric shape of the decollement, while slip propagates. In the inter-seismic interval the frontal prismrelaxes and fluid pressure drops. The frontal prismgoes into diffuse extension during the intervalwhen plate convergence is accommodated by creep along the ductile fault core. The fault core is typically a barrier to deformation, which is explained by its weak, but impermeable, nature. The localized development of a damage zone beneath the fault core is characterized by shear fracturing that appears as the result of local strengthening of the detachment.
Resumo:
Magmatic fluids, heat fluxes, and fluid/rock interactions associated with hydrothermal systems along spreading centers and convergent margins have a significant impact on the genesis of major sulfide deposits and biological communities. Circulation of hydrothermal fluids is one of the most fundamental processes associated with localized mineralization and is controlled by inherent porous and permeable properties of the ocean crust. Heat from magmatic intrusions drives circulation of seawater through permeable portions of the oceanic crust and upper mantle, discharging at the seafloor as both focused high-temperature (250°-400°C) fluids and diffuse lower-temperature (<250°C) fluids. This complex interaction between the circulating hydrothermal fluids and the oceanic basement greatly influences the physical properties and the composition of the crust (Thompson, 1983; Jacobson, 1992, doi:10.1029/91RG02811; Johnson and Semyan, 1994, doi:10.1029/93JB00717). During Ocean Drilling Program (ODP) Leg 193, 13 holes were drilled in the PACMANUS hydrothermal system (Binns, Barriga, Miller, et al., 2002, doi:10.2973/odp.proc.ir.193.2002). The hydrothermal system consists of isolated hydrothermal deposits lined along the main crest of the Pual Ridge, a 500- to 700-m-high felsic neovolcanic ridge in the eastern Manus Basin. The principal drilling targets were the Snowcap (Site 1188) and Roman Ruins (Site 1189) active hydrothermal fields. Samples from these two sites were used for a series of permeability, electrical resistivity, and X-ray computed tomography measurements.
Resumo:
To investigate the use of benthic foraminifera as a means to document ancient methane release, we determined the stable isotopic composition of tests of live (Rose Bengal stained) and dead specimens of epibenthic Fontbotia wuellerstorfi, preferentially used in paleoceanographic reconstructions, and of endobenthic high-latitude Cassidulina neoteretis and Cassidulina reniforme from a cold methane-venting seep off northern Norway. We collected foraminiferal tests from three push cores and nine multiple cores obtained with a remotely operated vehicle and a video-guided multiple corer, respectively. All sampled sites except one control site are situated at the Håkon Mosby mud volcano (HMMV) on the Barents Sea continental slope in 1250 m water depth. At the HMMV in areas densely populated by pogonophoran tube worms, d13C values of cytoplasm-containing epibenthic F. wuellerstorfi are by up to 4.4 per mil lower than at control site, thus representing the lowest values hitherto reported for this species. Live C. neoteretis and C. reniforme reach d13C values of -7.5 and -5.5 per mil Vienna Pee Dee Belemnite (VPDB), respectively, whereas d13C values of their empty tests are higher by 4 per mil and 3 per mil. However, d13C values of empty tests are never lower than those of stained specimens, although they are still lower than empty tests from the control site. This indicates that authigenic calcite precipitates at or below the sediment surface are not significantly influencing the stable isotopic composition of foraminiferal shells. The comparatively high d13C results rather from upward convection of pore water and fluid mud during active methane venting phases at these sites. These processes mingle tests just recently calcified with older ones secreted at intermittent times of less or no methane discharge. Since cytoplasm-containing specimens of suspension feeder F. wuellerstorfi are almost exclusively found attached to pogonophores, which protrude up to 3 cm above the sediment, and d13C values of bottom-water-dissolved inorganic carbon (DIC) are not significantly depleted, we conclude that low test d13C values of F. wuellerstorfi are the result of incorporation of heavily 13C-depleted methanotrophic biomass that these specimens feed on rather than because of low bottom water d13CDIC. Alternatively, the pogonophores, which are rooted at depth in the upper sediment column, may serve as a conduit for depleted d13CDIC that ultimately influences the calcification process of F. wuellerstorfi attached to the pogonophoran tube well above the sediment/water interface. The lowest d13C of live specimens of the endobenthic C. neoteretis and C. reniforme are within the range of pore water d13CDIC values, which exceed those that could be due to organic matter decomposition, and thus, in fact, document active methane release in the sediment.