804 resultados para Wandering cinema


Relevância:

20.00% 20.00%

Publicador:

Resumo:

The project aimed to analyse representations of motherhood in Polish cinema as a special case of a more general system within the representation of women. It concentrated on the image of the Polish Mother created during the 19th century in Polish culture under the influence of specific political, social and religious factors. Ms. Ostrowska's initial hypothesis was that this symbolic image became one of the most stable elements in Polish cinema and as her research revealed, it was valuable for the preservation of national identity but nevertheless a fiercely constraining model for Polish femininity. In order to fully understand the nature of this persistent image it was initially necessary to related it to broader contexts and issues in representation. These included the image of the Polish Mother within general mythological structures (using the notion of myth in the Barthesian sense). Following her initial research Ms. Ostrowska felt that it was most appropriate to view the myth of the Polish Mother as a dominant ideological structure in the discourse of motherhood within Polish culture. An analysis of the myth of the Polish Mother can provide an insight into how Polish society sees itself at different periods in time and how a national identity was constructed in relation to particular ideological demands stemming from concrete historical and political situations. The analysis of the film version of this myth also revealed some aspects of the national character of Polish cinema. There the image of woman has become enshrined as the "eternal feminine", with virtues which are inevitably derived directly from Catholicism, particularly in relation to the networks of meanings around the central figure of Mary, Mother of God. In 19th century Poland these were linked with patriotic values and images of woman became part of the defence of the very idea of Poland and Polishness. After World War Two, this religious-political image system was adapted to the demands of the new communist ideology. The possibility of manipulating the ideological dimensions of the myth of the Polish Mother is due to the very nature of the image, which as a symbol of civil religion had been able to function independently of any particular state or church institution. Although in communist ideology the stress was on the patriotic aspect of the myth, its pronounced religious aspect was also transmitted, consciously or not, in the denotation process, this being of great significance in the viewer's response to the female character. This appropriation of elements derived from the national patriotic tradition into the discourse of communist ideology was a very efficient strategy to establish the illusion of continuity in national existence, which was supposed to convince society of the rightness of the new political situation. The analysis of films made in the post-war period showed the persistence of this discourse on motherhood in a range of cinematic texts regardless of the changing political situation. Ms. Ostrowska claims that the stability of this discursive formation is to a certain extent the result of the mythological aspect of the mother figure. This mythological structure also belongs to the ideology of Romanticism which in general continues to prevail in Polish cultural discourse as a meta-language of national community. The analysis of the films confirmed the hypothesis of the Polish Mother as a myth-sign whose signifier is stable whereas the signified depends on the specific historical conditions in which it is set. Therefore in the famous propaganda documentary Kobiety naszych dni (Women of Our Days, 1951) by Jan Zelnik, and in other films made after the October 1956 "thaw" it functions as an "empty sign. She concludes that it would be difficult to deny that the myth of the Polish Mother has offered Polish women a special role in national life, granting them a high moral position in the social, hierarchy. However the processes of idealisation involved have resulted in a deprivation of her subjectivity and the right to decide about her own life. This idealisation also served to strengthen traditional patriarchal structures through this set of female obligations to the mother land. In Polish ideology it is not a man who demands sacrifice from a woman but the motherland, which, deprived of the institutions of male power for nearly 150 years, had functioned as a feminine structure. That is why oppressive aspects of the myth have been obscured for so long. While Polish women were doubtless able to accept the constrictions because of their sense of national duty and any misgivings were overridden by the argument of the cause, it is important to recognise that the strength of these constructions, compounded by the ways in which they spoke of and continue to speak of a certain perfection, make them persist into contemporary Poland. Poland is however no longer embattled and the signs that made these meanings are potentially empty. This space for meaning will be and is already being contested and increasingly colonised by current western models of femininity. Ms. Ostrowska's final question is whether this will help to prevent a possible resentful victimisation of the silent and noble Polish Mother.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 +/- 0.3 microM. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.

Relevância:

20.00% 20.00%

Publicador:

Resumo:

by A. Goldfaden. For piano arr. by Herman Fiedler

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Esta ponencia se concentra en un análisis del Free Cinema, procurando identificar las modificaciones que introdujo en el proceso de producción cinematográfica, su dimensión política y su afinidad con la reformulación crítica del marxismo emprendida por la Escuela de Birmingham. El Free Cinema es una corriente cinematográfica surgida en Gran Bretaña a mediados de la década de 1950, cuyas intenciones originales fueron explicitadas a través de una serie de manifiestos que acompañaron las primeras proyecciones del grupo. El manifiesto, punto de encuentro de las pasiones políticas y los impulsos estéticos, constituye un corpus privilegiado para iniciar un estudio de la articulación entre ambas dimensiones que luego se concentrará en las producciones audiovisuales. En primera instancia, la ponencia da cuenta de las rupturas formales y temáticas que caracterizan la irrupción del Free Cinema dentro del cine británico. A continuación, explora particularmente las transformaciones que supuso en los modos de representar y relacionarse con la clase obrera. Nos interesa rastrear cómo se manifiesta, en ese vínculo, un conjunto de asociaciones valorativas ligadas a formas específicas de alineamiento y compromiso político que colocan al Free Cinema en las proximidades de los Estudios Culturales

Relevância:

20.00% 20.00%

Publicador:

Resumo:

En la ponencia se describirán las estrategias de representación sobre la producción cinematográfica y la persona de Mario Moreno Cantinflas en la revista mexicana Cinema Reporter entre las décadas de 1940 y 1950. De la descripción se observarán cómo las estrategias enunciativas desplegadas en torno del actor, de sus producciones cinematográficas y de su personaje, favorecieron la identificación del comediante con la industria cinematográfica azteca, en perjuicio de la identificación que originalmente había establecido el personaje del 'peladito' con una audiencia popular y masiva

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Esta ponencia se concentra en un análisis del Free Cinema, procurando identificar las modificaciones que introdujo en el proceso de producción cinematográfica, su dimensión política y su afinidad con la reformulación crítica del marxismo emprendida por la Escuela de Birmingham. El Free Cinema es una corriente cinematográfica surgida en Gran Bretaña a mediados de la década de 1950, cuyas intenciones originales fueron explicitadas a través de una serie de manifiestos que acompañaron las primeras proyecciones del grupo. El manifiesto, punto de encuentro de las pasiones políticas y los impulsos estéticos, constituye un corpus privilegiado para iniciar un estudio de la articulación entre ambas dimensiones que luego se concentrará en las producciones audiovisuales. En primera instancia, la ponencia da cuenta de las rupturas formales y temáticas que caracterizan la irrupción del Free Cinema dentro del cine británico. A continuación, explora particularmente las transformaciones que supuso en los modos de representar y relacionarse con la clase obrera. Nos interesa rastrear cómo se manifiesta, en ese vínculo, un conjunto de asociaciones valorativas ligadas a formas específicas de alineamiento y compromiso político que colocan al Free Cinema en las proximidades de los Estudios Culturales

Relevância:

20.00% 20.00%

Publicador:

Resumo:

En la ponencia se describirán las estrategias de representación sobre la producción cinematográfica y la persona de Mario Moreno Cantinflas en la revista mexicana Cinema Reporter entre las décadas de 1940 y 1950. De la descripción se observarán cómo las estrategias enunciativas desplegadas en torno del actor, de sus producciones cinematográficas y de su personaje, favorecieron la identificación del comediante con la industria cinematográfica azteca, en perjuicio de la identificación que originalmente había establecido el personaje del 'peladito' con una audiencia popular y masiva

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Esta ponencia se concentra en un análisis del Free Cinema, procurando identificar las modificaciones que introdujo en el proceso de producción cinematográfica, su dimensión política y su afinidad con la reformulación crítica del marxismo emprendida por la Escuela de Birmingham. El Free Cinema es una corriente cinematográfica surgida en Gran Bretaña a mediados de la década de 1950, cuyas intenciones originales fueron explicitadas a través de una serie de manifiestos que acompañaron las primeras proyecciones del grupo. El manifiesto, punto de encuentro de las pasiones políticas y los impulsos estéticos, constituye un corpus privilegiado para iniciar un estudio de la articulación entre ambas dimensiones que luego se concentrará en las producciones audiovisuales. En primera instancia, la ponencia da cuenta de las rupturas formales y temáticas que caracterizan la irrupción del Free Cinema dentro del cine británico. A continuación, explora particularmente las transformaciones que supuso en los modos de representar y relacionarse con la clase obrera. Nos interesa rastrear cómo se manifiesta, en ese vínculo, un conjunto de asociaciones valorativas ligadas a formas específicas de alineamiento y compromiso político que colocan al Free Cinema en las proximidades de los Estudios Culturales