Performance of CMOS Devices in Silicon-on-Sapphire Films After Solid-Phase Epitaxial Growth With Rapid Electron-Beam Heating

The crystal quality of 0.3-μm-thick as-grown epitaxial silicon-on-sapphire (SOS) was improved using solid-phase epitaxy (SPE) by implantation with silicon to 1015 ions/cm2 at 175 keV and rapid annealing using electron-beam heating, n-channel and p-channel transistormobilities increased by 31 and 19 percent, respectively, and a reduction in ring-oscillator stage delay confirmed that crystal defects near the upper silicon surface had been removed. Leakage in n-channel transistors was not significantly affected by the regrowth process but for p-channel transistors back-channel leakage was considerably greater than for the control devices. This is attributed to aluminum released by damage to the sapphire during silicon implantation. © 1985 IEEE

A comparative approach to somatic cell nuclear transfer in the rhesus monkey

BACKGROUND: Despite the potential utility of primate somatic cell nuclear transfer (SCNT) to biomedical research and to the production of autologous embryonic stem (ES) cells for cell- or tissue-based therapy, a reliable method for SCNT is not yet availab

Superovulatory response to a low dose single-daily treatment of rhFSH dissolved in polyvinylpyrrolidone in rhesus monkeys

To simplify the procedure for superovulation in the rhesus monkey, this study was designed using polyvinylpyrrolidone (PVP) solution as a solvent for gonadotropins. Thirty-five cycling females (aged 5-8 years old) were divided into six groups during the b

Effects of rhFSH regimen and time interval on ovarian responses to repeated stimulation cycles in rhesus monkeys during a physiologic breeding season

We studied the effects of repeated stimulation by recombinant human FSH (rhFSH) at various time intervals during a physiologic breeding season in rhesus monkeys. Ovarian recovery and responses were assessed by ultrasonography, serum steroid concentrations

The successful double cryopreservation of rabbit (Oryctolagus cuniculus) semen in large volume using the directional freezing technique with reduced concentration of cryoprotectant

Using directional freezing, Our objective was to cryopreserve rabbit semen and achieve fertility that was equal or higher than that achieved with conventional freezing. The working hypothesis was that controlling the ice-front propagation would allow redu

Effect of sugar type on the survival of frozen-thawed rhesus monkey (Macaca mulatta) sperm

Sperm-freezing extenders supplemented with sugar or a combination of different sugars are widely used for the cryopreservation of nonhuman primate spermatozoa. Understanding which sugar or combination of sugars offers the highest level of cryoprotection w

Experimental study of homogenisation in grid turbulence

Turbulence statistics have been measured immediately downstream of a regular grid made of round rods with rod spacing M. 2D-2C PIV was used to analyse a measurement area of 14M x 4M in the down and cross-stream directions respectively. The relevant Reynolds number span the range Re M = U ∞M/ν = 5 500 - 16 500. The Reynolds shear stresses recorded on two parallel measurement planes differently located relative to the grid exhibit significant discrepancies over the first 5M, but have completely homogenised in the cross-stream direction by x/M = 7. The downstream evolution of the two-point velocity correlation functions shows a progressive loss of coherence and a clear trend towards the expected isotropic behavior. The same conclusions apply to measurements taken in the wake of another regular grid made of square rods. Changes in the vortex shedding pattern from the grid were observed at the lowest Reynolds number, with two of the four rod wakes captured shedding in phase with each other but in anti-phase with a third one. The impact of this early flow coherence on the turbulence statistics did not persist due to the homogenisation process.

In vitro activities of small peptides from snake venom against clinical isolates of drug-resistant Mycobacterium tuberculosis

The recent re-emergence of tuberculosis, especially the multidrug-resistant cases, has highlighted the importance of screening effective novel drugs against Mycobacterium tuberculosis. In this study, the in vitro activities of small peptides isolated from snake venom were investigated against multidrug-resistant M. tuberculosis. Minimum inhibitory concentrations (MICs) were determined by the Bactec TB-460 radiometric method. A small peptide with the amino acid sequence ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG (designated as vgf-1) from Naja atra (isolated from Yunnan province of China) venom had in vitro activity against clinically isolated multidrug-resistant strains of M. tuberculosis. The MIC was 8.5 mg/l. The antimycobacterial domain of this 60aa peptide is under investigation. (C) 2003 Elsevier Science B.V. and the International Society of Chemotherapy. All rights reserved.

2D PIV measurements in the near field of grid turbulence using stitched fields from multiple cameras

We present measurements of grid turbulence using 2D particle image velocimetry taken immediately downstream from the grid at a Reynolds number of Re M = 16500 where M is the rod spacing. A long field of view of 14M x 4M in the down- and cross-stream directions was achieved by stitching multiple cameras together. Two uniform biplanar grids were selected to have the same M and pressure drop but different rod diameter D and crosssection. A large data set (10 4 vector fields) was obtained to ensure good convergence of second-order statistics. Estimations of the dissipation rate ε of turbulent kinetic energy (TKE) were found to be sensitive to the number of meansquared velocity gradient terms included and not whether the turbulence was assumed to adhere to isotropy or axisymmetry. The resolution dependency of different turbulence statistics was assessed with a procedure that does not rely on the dissipation scale η. The streamwise evolution of the TKE components and ε was found to collapse across grids when the rod diameter was included in the normalisation. We argue that this should be the case between all regular grids when the other relevant dimensionless quantities are matched and the flow has become homogeneous across the stream. Two-point space correlation functions at x/M = 1 show evidence of complex wake interactions which exhibit a strong Reynolds number dependence. However, these changes in initial conditions disappear indicating rapid cross-stream homogenisation. On the other hand, isotropy was, as expected, not found to be established by x/M = 12 for any case studied. © Springer-Verlag 2012.

Polymer waveguide-based backplanes for board-level optical interconnects

Optical interconnects are increasingly considered for use in high-performance electronic systems. Multimode polymer waveguides are a promising technology for the formation of optical backplane as they enable cost-effective integration of optical links onto standard printed circuit boards. In this paper, two different types of polymer waveguide-based optical backplanes are presented. The first one implements a passive shuffle architecture enabling non-blocking on-board optical interconnection between different cards/modules, while the second one deploys a regenerative bus architecture allowing the interconnection of an arbitrary number of electrical cards over a common optical bus. The polymer materials and the multimode waveguide components used to form the optical backplanes are presented, while details of the interconnection architectures and design of the backplanes are described. Proof-of-principle demonstrators fabricated onto low-cost FR4 substrates, including a 10-card 1 Tb/s-capacity passive shuffle router and 4-channel 3-card polymeric bus modules, are reported and their optical performance characteristics are presented. Low-loss, low-crosstalk on-board interconnection is achieved and error-free (BER10 12) 10 Gb/s communication between different card/module interfaces is demonstrated in both polymeric backplane systems. © 2012 IEEE.