969 resultados para 20S-15N
Resumo:
Urease is a nickel-dependent enzyme that catalyzes hydrolysis of urea in the last step of organic nitrogen mineralization. Its active site contains a dinuclear center for Ni(II) ions that must be inserted into the apo-enzyme through the action of four accessory proteins (UreD, UreE, UreF, UreG) leading to activation of urease. UreE, acting as a metallo-chaperone, delivers Ni(II) to the preformed complex of apo-urease-UreDFG and has the capability to enhance the GTPase activity of UreG. This study, focused on characterization of UreE from Sporosarcina pasteurii (SpUreE), represents a piece of information on the structure/mobility-function relationships that control nickel binding by SpUreE and its interaction with SpUreG. A calorimetric analysis revealed the occurrence of a binding event between these proteins with positive cooperativity and a stoichiometry consistent with the formation of the (UreE)2-(UreG)2 hetero-oligomer complex. Chemical Shift Perturbations induced by the protein-protein interaction were analyzed using high-resolution NMR spectroscopy, which allowed to characterize the molecular details of the protein surface of SpUreE involved in the complex formation with SpUreG. Moreover, backbone dynamic properties of SpUreE, determined using 15N relaxation analysis, revealed a general mobility in the nanoseconds time-scale, with the fastest motions observed at the C-termini. The latter analysis made it possible for the first time to characterize of the C-terminal portions, known to contain key residues for metal ion binding, that were not observed in the crystal structure of UreE because of disorder. The residues belonging to this portion of SpUreE feature large CSPs upon addition of SpUreG, showing that their chemical environment is directly affected by protein-protein interaction. Metal ion selectivity and affinity of SpUreE for cognate Ni(II) and non cognate Zn(II) metal ions were determined, and the ability of the protein to select Ni(II) over Zn(II), in consistency with the proposed role in Ni(II) cations transport, was established.
Resumo:
Scopo dello studio: valutare i cambiamenti indotti da diversi trattamenti di mordenzatura sulla morfologia superficiale e sulla microstruttura di due vetro-ceramiche a base disilicato di litio (IPS e.max® Press e IPS e.max® CAD) ed esaminarne gli effetti sia sull’adesione con un cemento resinoso che sulla resistenza alla flessione. Materiali e metodi: Settanta dischetti (12 mm di diametro, 2 mm di spessore) di ogni ceramica sono stati preparati e divisi in 5 gruppi: nessun trattamento (G1), HF 5% 20s (G2), HF 5% 60s (G3), HF 9.6% 20s (G4), HF 9.6% 60s (G5). Un campione per ogni gruppo è stato analizzato mediante profilometro ottico e osservato al SEM. Per gli altri campioni è stato determinato lo shear bond strength (SBS) con un cemento resinoso. Dopo l’SBS test, i campioni sono stati caricati fino a frattura utilizzando il piston-on-three-ball test per determinarne la resistenza biassiale alla flessione. Risultati: L’analisi morfologica e microstrutturale dei campioni ha rivelato come diversi trattamenti di mordenzatura producano delle modifiche nella rugosità superficiale che non sono direttamente collegate ad un aumento dei valori di adesione e dei cambiamenti microstrutturali che sono più rilevanti con l’aumento del tempo di mordenzatura e di concentrazione dell’acido. I valori medi di adesione (MPa) per IPS e.max® CAD sono significativamente più alti in G2 e G3 (21,28 +/- 4,9 e 19,55 +/- 5,41 rispettivamente); per IPS e.max® Press, i valori più elevati sono in G3 (16,80 +/- 3,96). La resistenza biassiale alla flessione media (MPa) è più alta in IPS e.max® CAD (695 +/- 161) che in IPS e.max® Press (588 +/- 117), ma non è non influenzata dalla mordenzatura con HF. Conclusioni: il disilicato di litio va mordenzato preferibilmente con HF al 5%. La mordenzatura produce alcuni cambiamenti superficiali e microstrutturali nel materiale, ma tali cambiamenti non ne influenzano la resistenza in flessione.
Resumo:
Diese Arbeit legt, im Rahmen eines interdisziplinären BMBF Projekts, die Grundlage für eine neue, potentielle Früherkennungsmethode für Prostatakrebs. Ausgehend von der Idee, einen sensitiv detektierbaren Farbstoff in selektiv, Hepsin-spaltbare Kapseln einzubringen, wurde ein Modellsystem erarbeitet. Als Zielsubstrat für das Enzym Hepsin wurde die Sequenz RQLRVVGG identifiziert. Basierend auf dem hier entwickelten Modell, könnte in Zukunft eine Detektion von Hepsin und damit von Prostatakrebs im Frühstadium in vivo erfolgen. rnUm das Konzept der Enzymspaltbarkeit zu zeigen,wurden, basierend auf einem Modell,enzymatisch-spaltbare, polymere Nanopartikeldargestellt. In dieser Arbeit konnte die Synthese von vier Generationen spezifisch Protease-spaltbarer, hydrophober Nanopartikel gezeigt werden. Die Enzyme Pepsin und Trypsin, die selektiv die Peptidsequenz GFF spalten, wurden als Modellenzyme für das im Prostatakarzinom überexprimierte Hepsin eingesetzt. rnrnAls Ausgangspolymer diente Poly(styrol-co-acrylsäure), das in freier, radikalischer Polymerisation hergestellt und mit Molekulargewichten zwischen 8500 und 49400 g/mol erhalten wurde. Der Funktionalisierungsgrad wurde zwischen 5 und 16%-Gew. variiert. Die Charakterisierung erfolgte mittels GPC und NMR-Spektroskopie. In einer polymeranalogen Reaktion wurden die Säurefunktionen zu Aminogruppen umgesetzt. Die resultierendenPolymere wurden unter Einsatz der über Jahrzehnte entwickelten, effektiven Peptidkupplungschemie mit enzymspaltbarenPeptiden gekuppelt, um dadurch definierte Peptid-Polymer-Konjugate zu erhalten.Als enzymatisch spaltbarer Teil des Konjugats, wurden mithilfe der Festphasenpeptidsynthese (SPPS),FRET(Fluoreszenz-Resonanz-Energie-Transfer)-markiertePeptide synthetisiert, die auf der Trypsin-spaltbaren Sequenz GFF basierten. Zum Nachweis der Vernetzung der späteren Nanopartikel, wurde zusätzlich einern15N-markierte Aminosäure (Fmoc-(15N)-Glycin) am N-Terminus der Peptide eingebaut, um die Reaktion des Amins zu einem Amid verfolgen zu können.Die Charakterisierung der Peptide erfolgte mittels1H-, 13C-NMR-Spektroskopie, MALDI TOF-MS und HPLC. Aus den Polymeren und dem Peptid wurden Peptid-Polymer-Konjugate hergestellt und die erfolgreiche Anbindung mittels DOSY-NMR-Spektroskopie und HPLC nachgewiesen. Aus den Konjugaten konnten im nächsten Schritt, durch Anwendung des inversen Miniemulsionsprozesses, Nanopartikel formuliertund diese in wässriges Milieu überführt werden. Die Dispersionen konnten mittels PCCS, REM und Zetapotentialmessungen charakterisiert werden, wobei Partikeldurchmesser um 230 nm resultierten. Der Nachweis der Vernetzung des Polymers in den Partikeln konnte durch die Reaktion desrn15N-Amins zu einem 15N-Amid mittels 15N-Festkörper-NMR-Spektroskopie nachverfolgt werden. Abschließend konnten die Partikel durch Trypsin gespalten werden, was durch das eingebaute FRET-Paar über eine in situ Detektion der relativen Fluoreszenz erfolgte. rnIn dieser Arbeit konnten Peptid-vernetzte, Polystyrol basierte Nanopartikel hergestellt und in Heterophase von Trypsin gespalten werden.rn
Resumo:
La tesi ha per oggetto la cultura ebraica cretese nei secoli XIV-XVI e, in particolare, l’influsso esercitato su di essa dalla cultura e dalle tradizioni degli ebrei sefarditi e ashkenaziti che cominciarono a stabilirsi sull’isola a partire dalla metà del Trecento. La tesi si basa da un lato su fonti amministrative e notarili e, dall’altro, sui manoscritti ebraici prodotti o portati a Candia nel periodo considerato. Il primo capitolo tratta della comunità ebraica nel primo Cinquecento e porta nuove notizie a proposito della geografia della zudeca, delle sue sinagoghe, della sua composizione sociale, dell’entità della sua popolazione e della biografia del principale leader spirituale e culturale attivo a Candia a quell’epoca: Elia Capsali. Il secondo capitolo offre una panoramica sull’immigrazione ebraica a Candia nei secoli XIV-XV. Il terzo capitolo esplora alcune particolarità della liturgia sinagogale elaborata dagli ebrei candioti sotto l’influsso della tradizione ashkenazita. Il quarto capitolo tratta di due liste di libri databili alla seconda metà del Quattrocento (Bologna, Biblioteca Universitaria, ms. 3574 B) e suggerisce di considerarle come indicative del peso che ebbero alcuni immigrati ebrei catalani nella diffusione della cultura medica sefardita a Candia. Il quinto capitolo è dedicato al medico, filosofo e astronomo Mosheh ben Yehudah Galiano, il quale visse a Candia tra la seconda metà degli anni Venti del Cinquecento e il 1543. L’ultimo capitolo tratta degli effetti provocati dall’epidemia di peste del 1592-95 all’interno della zudeca di Candia.
Resumo:
Salpetrige Säure (HONO) ist eine wichtige Form von reaktivem Stickstoff, die aufgrund ihrer Photolyse zu Stickstoffmonoxid (NO) und dem Hydroxylradikal (OH), sehr kurzlebig ist. Ein genaues Verständnis der Quellen und Senken von HONO ist eine grundlegende Voraussetzung, um dessen Einfluss auf die Umwelt zu beurteilen. Allerdings wird immer noch nach einer starken HONO-Quelle am Tag gesucht und nächtliche HONO-Deposition auf den Boden wurde bisher stets nur postuliert. Diese Dissertation folgt der Zielsetzung die Prozesse der HONO-Aufnahme und Freisetzung von Böden aufzudecken und die zugrunde liegenden Mechanismen zu verstehen.rnUm die Rolle von HONO-Bodenemissionen zu quantifizieren, wurden 17 Böden in einem dynamischen Kammersystem untersucht. Es konnten HONO-Emissionen derselben Größenordnung wie die bereits gut untersuchten NO-Emissionen festgestellt werden. Unerwarteter Weise wurden die stärksten Emissionen bei Böden mit neutralem pH aus ariden und landwirt¬schaftlichen Gebieten beobachtet. Die Temperaturabhängigkeit der Bodenemissionen von HONO und NO führten zu der Annahme einer mikrobiellen Freisetzung von HONO, welche durch Reinkulturexperimente mit dem ammoniumoxidierenden Bakterium Nitrosomonas europaea bestätigt werden konnte. Ein konzeptionelles Model für die Freisetzung reaktiver Stickstoffverbindungen aus Böden in Abhängigkeit des Bodenwassergehaltes wurde um HONO-Emissionen erweitert.rnDurch Nachweise mittels Reinkultur- und Inhibitionsexperimenten konnten weitere Untersuchungen der bakteriellen Freisetzung von HONO aus Böden zeigen, dass innerhalb der bakteriellen Nitrifikation nur ammoniumoxidierende Bakterien zur Emission von HONO fähig sind. Durch kontrolliert initiierte Zelllyse konnte gezeigt werden, dass intrazellulär akkumuliertes Hydroxylamin (NH2OH) für die HONO-Freisetzung verantwortlich sind. Zum ersten Mal wurde NH2OH in der Gasphase nachgewiesen und dass dieses über den gesamten Bodenfeuchtebereich von ammoniumoxidierenden Bakterien freigesetzt wird. Es wurde gezeigt, dass die heterogene Reaktion von NH2OH mit Wasserdampf auf einer Glasperlenoberfläche HONO bildet. Diese Reaktion erklärt die beobachtete Freisetzung von HONO bei niedrigen Bodenfeuchten, da nur dann die Oberfläche zur Reaktion zur Verfügung steht und nicht von Wasser bedeckt ist.rnEine 15N Isotopenmarkierungsmethode wurde entwickelt um isotopenmarkiertes gasförmiges HONO zu messen, was die Untersuchung der Bildungsprozesse von HONO und dessen Rolle in biogeochemischen Zyklen ermöglicht. Die Anwendung dieser neuen Methode auf eine Bodenprobe die mit 15N Harnstoff angereichert und in einem dynamischen Kammersystem untersucht wurde, bestätigt die obigen Ergebnisse einer starken mikrobiellen Beteiligung von Bodenbakterien zur HONO Freisetzung.rnBidirektionale Flüsse von HONO wurden für sechs untersuchte Bodenproben gefunden. Die Richtung der Flüsse hängt dabei vom Umgebungsmischungsverhältnis von HONO und dem Bodenwassergehalt ab. Eine wichtige Größe, die die bidirektionalen Flüsse von HONO beschreibt, ist das „Ökosystem spezifische Kompensationsmischungsverhältnis von HONO“, χcomp. Dieser neue Begriff wurde definiert und eingeführt, da die verschiedenen in den Bodenaustausch von HONO involvierten Prozesse nicht mit dem klassischen Kompensationspunktkonzept kompatibel sind. Die Untersuchungen bestätigen neueste Feldbeobachtungen, dass HONO, welches bei hohen Umgebungsmischungsverhältnissen vom Boden adsorbiert wird, bei niedrigen Mischungsverhält-nissen wieder vom Boden desorbiert wird. Folglich wird nächtlich akkumuliertes HONO tagsüber in eine Quelle für HONO umgewandelt. Vier Prozesse - Verteilung von HONO zwischen Gas- und Flüssigphase nach Henrys Gesetz, bakterielle HONO Bildung aus NH2OH, Adsorption und Desorption von HONO - und deren Dominanz in speziellen Bodenfeuchtebereichen wurden identifiziert. Dadurch wurde ein konzeptionelles Model für die Prozesse, die in Aufnahme und Freisetzung von HONO aus Böden involviert sind, als Funktion der Bodenfeuchte entwickelt.rnZusammenfassend hat diese Dissertation die entscheidenden Prozesse im Austausch von HONO zwischen Boden und Atmosphäre aufgeklärt und den der bakteriellen HONO Bildung zugrunde liegenden Mechanismus aufgedeckt. Es konnte gezeigt werden, dass Böden sowohl eine wichtige Quelle als auch eine Senke für HONO sind und sollten folglich in zukünftigen Feldmessungen stärker berücksichtigt werden.rn
Resumo:
Der atmosphärische Kreislauf reaktiver Stickstoffverbindungen beschäftigt sowohl die Naturwissenschaftler als auch die Politik. Dies ist insbesondere darauf zurückzuführen, dass reaktive Stickoxide die Bildung von bodennahem Ozon kontrollieren. Reaktive Stickstoffverbindungen spielen darüber hinaus als gasförmige Vorläufer von Feinstaubpartikeln eine wichtige Rolle und der Transport von reaktivem Stickstoff über lange Distanzen verändert den biogeochemischen Kohlenstoffkreislauf des Planeten, indem er entlegene Ökosysteme mit Stickstoff düngt. Die Messungen von stabilen Stickstoffisotopenverhältnissen (15N/14N) bietet ein Hilfsmittel, welches es erlaubt, die Quellen von reaktiven Stickstoffverbindungen zu identifizieren und die am Stickstoffkeislauf beteiligten Reaktionen mithilfe ihrer reaktionsspezifischen Isotopenfraktionierung genauer zu untersuchen. rnIn dieser Doktorarbeit demonstriere ich, dass es möglich ist, mit Hilfe von Nano-Sekundärionenmassenspektrometrie (NanoSIMS) verschiedene stickstoffhaltige Verbindungen, die üblicherweise in atmosphärischen Feinstaubpartikeln vorkommen, mit einer räumlichen Auflösung von weniger als einem Mikrometer zu analysieren und zu identifizieren. Die Unterscheidung verschiedener stickstoffhaltiger Verbindungen erfolgt anhand der relativen Signalintensitäten der positiven und negativen Sekundärionensignale, die beobachtet werden, wenn die Feinstaubproben mit einem Cs+ oder O- Primärionenstrahl beschossen werden. Die Feinstaubproben können direkt auf dem Probenahmesubstrat in das Massenspektrometer eingeführt werden, ohne chemisch oder physikalisch aufbereited zu werden. Die Methode wurde Mithilfe von Nitrat, Nitrit, Ammoniumsulfat, Harnstoff, Aminosären, biologischen Feinstaubproben (Pilzsporen) und Imidazol getestet. Ich habe gezeigt, dass NO2 Sekundärionen nur beim Beschuss von Nitrat und Nitrit (Salzen) mit positiven Primärionen entstehen, während NH4+ Sekundärionen nur beim Beschuss von Aminosäuren, Harnstoff und Ammoniumsalzen mit positiven Primärionen freigesetzt werden, nicht aber beim Beschuss biologischer Proben wie z.B. Pilzsporen. CN- Sekundärionen werden beim Beschuss aller stickstoffhaltigen Verbindungen mit positiven Primärionen beobachtet, da fast alle Proben oberflächennah mit Kohlenstoffspuren kontaminiert sind. Die relative Signalintensität der CN- Sekundärionen ist bei kohlenstoffhaltigen organischen Stickstoffverbindungen am höchsten.rnDarüber hinaus habe ich gezeigt, dass an reinen Nitratsalzproben (NaNO3 und KNO3), welche auf Goldfolien aufgebracht wurden speziesspezifische stabile Stickstoffisotopenverhältnisse mithilfe des 15N16O2- / 14N16O2- - Sekundärionenverhältnisses genau und richtig gemessen werden können. Die Messgenauigkeit auf Feldern mit einer Rastergröße von 5×5 µm2 wurde anhand von Langzeitmessungen an einem hausinternen NaNO3 Standard als ± 0.6 ‰ bestimmt. Die Differenz der matrixspezifischen instrumentellen Massenfraktionierung zwischen NaNO3 und KNO3 betrug 7.1 ± 0.9 ‰. 23Na12C2- Sekundärionen können eine ernst zu nehmende Interferenz darstellen wenn 15N16O2- Sekundärionen zur Messung des nitratspezifischen schweren Stickstoffs eingesetzt werden sollen und Natrium und Kohlenstoff im selben Feinstaubpartikel als interne Mischung vorliegt oder die natriumhaltige Probe auf einem kohlenstoffhaltigen Substrat abgelegt wurde. Selbst wenn, wie im Fall von KNO3, keine derartige Interferenz vorliegt, führt eine interne Mischung mit Kohlenstoff im selben Feinstaubpartikel zu einer matrixspezifischen instrumentellen Massenfraktionierung die mit der folgenden Gleichung beschrieben werden kann: 15Nbias = (101 ± 4) ∙ f − (101 ± 3) ‰, mit f = 14N16O2- / (14N16O2- + 12C14N-). rnWird das 12C15N- / 12C14N- Sekundärionenverhältnis zur Messung der stabilen Stickstoffisotopenzusammensetzung verwendet, beeinflusst die Probematrix die Messungsergebnisse nicht, auch wenn Stickstoff und Kohlenstoff in den Feinstaubpartikeln in variablen N/C–Verhältnissen vorliegen. Auch Interferenzen spielen keine Rolle. Um sicherzustellen, dass die Messung weiterhin spezifisch auf Nitratspezies eingeschränkt bleibt, kann eine 14N16O2- Maske bei der Datenauswertung verwendet werden. Werden die Proben auf einem kohlenstoffhaltigen, stickstofffreien Probennahmesubstrat gesammelt, erhöht dies die Signalintensität für reine Nitrat-Feinstaubpartikel.
Resumo:
In questo lavoro si è tentato di fornire un metodo per la calibrazione di modelli numerici in analisi dinamiche spettrali. Attraverso una serie di analisi time history non lineari sono stati ottenuti gli spostamenti relativi orizzontali che nascono, in corrispondenza della connessione trave-pilastro di tipo attritivo, quando una struttura prefabbricata monopiano viene investita dalla componente orizzontale e verticale del sisma. Con un procedimento iterativo su varie analisi spettrali sono state calibrate delle rigidezze equivalenti che hanno permesso di ottenere, con buona approssimazione, gli stessi risultati delle analisi time history. Tali rigidezze sono state poi restituite in forma grafica. Per riprodurre gli spostamenti relativi orizzontali con un’analisi dinamica spettrale è quindi possibile collegare le travi ai pilastri con degli elementi elastici aventi rigidezza Kcoll. I valori di rigidezza restituiti da questo studio valgono per un’ampia gamma di prefabbricati monopiano (periodo proprio 0.20s < T < 2.00s) e tre differenti livelli di intensità sismica; inoltre è stata data la possibilità di considerare la plasticizzazione alla base dei pilastri e di scegliere fra due diverse posizioni nei confronti della rottura di faglia (Near Fault System o Far Fault System). La diminuzione di forza d’attrito risultante (a seguito della variazione dell’accelerazione verticale indotta dal sisma) è stata presa in considerazione utilizzando un modello in cui fra trave e pilastro è posto un isolatore a pendolo inverso (opportunamente calibrato per funzionare come semplice appoggio ad attrito). Con i modelli lineari equivalenti si riescono ad ottenere buoni risultati in tempi relativamente ridotti: è possibile così compiere delle valutazioni approssimate sulla perdita di appoggio e sulle priorità d’intervento in una determinata zona sismica.
Resumo:
Over the recent years chirped-pulse, Fourier-transform microwave (CP-FTMW) spectrometers have chan- ged the scope of rotational spectroscopy. The broad frequency and large dynamic range make possible structural determinations in molecular systems of increasingly larger size from measurements of heavy atom (13C, 15N, 18O) isotopes recorded in natural abundance in the same spectrum as that of the parent isotopic species. The design of a broadband spectrometer operating in the 2–8 GHz frequency range with further improvements in sensitivity is presented. The current CP-FTMW spectrometer performance is benchmarked in the analyses of the rotational spectrum of the water heptamer, (H2O)7, in both 2– 8 GHz and 6–18 GHz frequency ranges. Two isomers of the water heptamer have been observed in a pulsed supersonic molecular expansion. High level ab initio structural searches were performed to pro- vide plausible low-energy candidates which were directly compared with accurate structures provided from broadband rotational spectra. The full substitution structure of the most stable species has been obtained through the analysis of all possible singly-substituted isotopologues (H218O and HDO), and a least-squares rm(1) geometry of the oxygen framework determined from 16 different isotopic species compares with the calculated O–O equilibrium distances at the 0.01 Å level.
Resumo:
Knowledge of the fate of deposited N in the possibly N-limited, highly biodiverse north Andean forests is important because of the possible effects of N inputs on plant performance and species composition. We analyzed concentrations and fluxes of NO3 −–N, NH4 +–N and dissolved organic N (DON) in rainfall, throughfall, litter leachate, mineral soil solutions (0.15–0.30 m depths) and stream water in a montane forest in Ecuador during four consecutive quarters and used the natural 15N abundance in NO3 − during the passage of rain water through the ecosystem and bulk δ15N values in soil to detect N transformations. Depletion of 15N in NO3 − and increased NO3 −–N fluxes during the passage through the canopy and the organic layer indicated nitrification in these compartments. During leaching from the organic layer to mineral soil and stream, NO3 − concentrations progressively decreased and were enriched in 15N but did not reach the δ15N values of solid phase organic matter (δ15N = 5.6–6.7‰). This suggested a combination of nitrification and denitrification in mineral soil. In the wettest quarter, the δ15N value of NO3 − in litter leachate was smaller (δ15N = −1.58‰) than in the other quarters (δ15N = −9.38 ± SE 0.46‰) probably because of reduced mineralization and associated fractionation against 15N. Nitrogen isotope fractionation of NO3 − between litter leachate and stream water was smaller in the wettest period than in the other periods probably because of a higher rate of denitrification and continuous dilution by isotopically lighter NO3 −–N from throughfall and nitrification in the organic layer during the wettest period. The stable N isotope composition of NO3 − gave valuable indications of N transformations during the passage of water through the forest ecosystem from rainfall to the stream.
Resumo:
Methane and nitrous oxide are important greenhouse gases which show a strong increase in atmospheric mixing ratios since pre-industrial time as well as large variations during past climate changes. The understanding of their biogeochemical cycles can be improved using stable isotope analysis. However, high-precision isotope measurements on air trapped in ice cores are challenging because of the high susceptibility to contamination and fractionation. Here, we present a dry extraction system for combined CH4 and N2O stable isotope analysis from ice core air, using an ice grating device. The system allows simultaneous analysis of δD(CH4) or δ13C(CH4), together with δ15N(N2O), δ18O(N2O) and δ15N(NO+ fragment) on a single ice core sample, using two isotope mass spectrometry systems. The optimum quantity of ice for analysis is about 600 g with typical "Holocene" mixing ratios for CH4 and N2O. In this case, the reproducibility (1σ ) is 2.1‰ for δD(CH4), 0.18‰ for δ13C(CH4), 0.51‰ for δ15N(N2O), 0.69‰ for δ18O(N2O) and 1.12‰ for δ15N(NO+ fragment). For smaller amounts of ice the standard deviation increases, particularly for N2O isotopologues. For both gases, small-scale intercalibrations using air and/or ice samples have been carried out in collaboration with other institutes that are currently involved in isotope measurements of ice core air. Significant differences are shown between the calibration scales, but those offsets are consistent and can therefore be corrected for.
Resumo:
The clinical use of anthracyclines in cancer therapy is limited by dose-dependent cardiotoxicity that involves cardiomyocyte injury and death. We have tested the hypothesis that anthracyclines affect protein degradation pathways in adult cardiomyocytes. To this aim, we assessed the effects of doxorubicin (Doxo) on apoptosis, autophagy and the proteasome/ubiquitin system in long-term cultured adult rat cardiomyocytes. Accumulation of poly-ubiquitinated proteins, increase of cathepsin-D-positive lysosomes and myofibrillar degradation were observed in Doxo-treated cardiomyocytes. Chymotrypsin-like activity of the proteasome was initially increased and then inhibited by Doxo over a time-course of 48 h. Proteasome 20S proteins were down-regulated by higher doses of Doxo. The expression of MURF-1, an ubiquitin-ligase specifically targeting myofibrillar proteins, was suppressed by Doxo at all concentrations measured. Microtubule-associated protein 1 light chain 3B (LC3)-positive punctae and both LC3-I and -II proteins were induced by Doxo in a dose-dependent manner, as confirmed by using lentiviral expression of green fluorescence protein bound to LC3 and live imaging. The lysosomotropic drug chloroquine led to autophagosome accumulation, which increased with concomitant Doxo treatment indicating enhanced autophagic flux. We conclude that Doxo causes a downregulation of the protein degradation machinery of cardiomyocytes with a resulting accumulation of poly-ubiquitinated proteins and autophagosomes. Although autophagy is initially stimulated as a compensatory response to cytotoxic stress, it is followed by apoptosis and necrosis at higher doses and longer exposure times. This mechanism might contribute to the late cardiotoxicity of anthracyclines by accelerated aging of the postmitotic adult cardiomyocytes and to the susceptibility of the aging heart to anthracycline cancer therapy.
Resumo:
Central European lake whitefish (Coregonus spp.) colonized Swiss lakes following the last glacial retreat and have undergone rapid speciation and adaptive radiation. Up to six species have been shown to coexist in some lakes, and individual species occupy specific ecological niches and have distinct feeding and reproductive ecologies. We studied methylmercury (MeHg) accumulation in sympatric whitefish species from seven Swiss lakes to determine if ecological divergence has led to different rates of MeHg bioaccumulation. In four of seven lakes, sympatric species had distinctly different MeHg levels, which varied by up to a factor of two between species. Generally, species with greater MeHg levels were smaller in body size and planktivorous, and species with lower MeHg were larger and benthivorous. While modest disparities in trophic position between species might be expected a priori to explain the divergence in MeHg, δ15N of bulk tissue did not correlate with fish MeHg in five of seven lakes. Results of a nested ANCOVA analysis across all lakes indicated that only two factors (species, lake) explained substantial portions of the variance, with species accounting for more variance (52 %) than inter-lake differences (32 %). We suggest that differences in MeHg accumulation were likely caused by diverging metabolic traits between species, such as differences in energy partitioning between anabolism and catabolism, potentially interacting with species-specific prey resource utilization. These results indicate substantial variability in MeHg accumulation between closely related fish species, illustrating that ecological speciation in fish can lead to divergent MeHg accumulation patterns.
Resumo:
High-resolution measurements of chemical impurities and methane concentrations in Greenland ice core samples from the early glacial period allow the extension of annual-layer counted chronologies and the improvement of gas age-ice age difference (Δage) essential to the synchronization of ice core records. We report high-resolution measurements of a 50 m section of the NorthGRIP ice core and corresponding annual layer thicknesses in order to constrain the duration of the Greenland Stadial 22 (GS-22) between Greenland Interstadials (GIs) 21 and 22, for which inconsistent durations and ages have been reported from Greenland and Antarctic ice core records as well as European speleothems. Depending on the chronology used, GS-22 occurred between approximately 89 (end of GI-22) and 83 kyr b2k (onset of GI-21). From annual layer counting, we find that GS-22 lasted between 2696 and 3092 years and was followed by a GI-21 pre-cursor event lasting between 331 and 369 yr. Our layer-based counting agrees with the duration of stadial 22 as determined from the NALPS speleothem record (3250 ± 526 yr) but not with that of the GICC05modelext chronology (2620 yr) or an alternative chronology based on gas-marker synchronization to EPICA Dronning Maud Land ice core. These results show that GICC05modelext overestimates accumulation and/or underestimates thinning in this early part of the last glacial period. We also revise the possible ranges of NorthGRIP Δdepth (5.49 to 5.85 m) and Δage (498 to 601 yr) at the warming onset of GI-21 as well as the Δage range at the onset of the GI-21 precursor warming (523 to 654 yr), observing that temperature (represented by the δ15N proxy) increases before CH4 concentration by no more than a few decades.
Resumo:
The identification of 15N-labeled 3-nitrotyrosine (NTyr) by gas chromatography/mass spectroscopy in protein hydrolyzates from activated RAW 264.7 macrophages incubated with 15N-L-arginine confirms that nitric oxide synthase (NOS) is involved in the nitration of protein-bound tyrosine (Tyr). An assay is presented for NTyr that employs HPLC with tandem electrochemical and UV detection. The assay involves enzymatic hydrolysis of protein, acetylation, solvent extraction, O-deacetylation, and dithionite reduction to produce an analyte containing N-acetyl-3-aminotyrosine, an electrochemically active derivative of NTyr. We estimate the level of protein-bound NTyr in normal rat plasma to be approximately 0-1 residues per 10(6) Tyr with a detection limit of 0.5 per 10(7) Tyr when > 100 nmol of Tyr is analyzed and when precautions are taken to limit nitration artifacts. Zymosan-treated RAW 264.7 cells were shown to have an approximately 6-fold higher level of protein-bound NTyr compared with control cells and cells treated with N(G)-monomethyl-L-arginine, an inhibitor of NOS. Intraperitoneal injection of F344 rats with zymosan led to a marked elevation in protein-bound NTyr to approximately 13 residues per 10(6) Tyr, an approximately 40-fold elevation compared with plasma protein of untreated rats; cotreatment with N(G)-monomethyl-L-arginine inhibited the formation of NTyr in plasma protein from blood and peritoneal exudate by 69% and 53%, respectively. This assay offers a highly sensitive and quantitative approach for investigating the role of reactive byproducts of nitric oxide in the many pathological conditions and disease states associated with NO(X) exposure such as inflammation and smoking.
Resumo:
Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 +/- 0.3 microM. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.