Comportamiento frente a la durabilidad de morteros de reparación de cemento modificados con polímeros

El auge que ha surgido en los últimos años por la reparación de edificios y estructuras construidas con hormigón ha llevado al desarrollo de morteros de reparación cada vez más tecnológicos. En el desarrollo de estos morteros por parte de los fabricantes, surge la disyuntiva en el uso de los polímeros en sus formulaciones, por no encontrarse justificado en ocasiones el trinomio prestaciones/precio/aplicación. En esta tesis se ha realizado un estudio exhaustivo para la justificación de la utilización de estos morteros como morteros de reparación estructural como respuesta a la demanda actual disponiéndolo en tres partes: En la primera parte se realizó un estudio del arte de los morteros y sus constituyentes. El uso de los morteros se remonta a la antigüedad, utilizándose como componentes yeso y cal fundamentalmente. Los griegos y romanos desarrollaron el concepto de morteros de cal, introduciendo componentes como las puzolanas, cales hidraúlicas y áridos de polvo de mármol dando origen a morteros muy parecidos a los hormigones actuales. En la edad media y renacimiento se perdió la tecnología desarrollada por los romanos debido al extenso uso de la piedra en las construcciones civiles, defensivas y religiosas. Hubo que esperar hasta el siglo XIX para que J. Aspdin descubriese el actual cemento como el principal compuesto hidraúlico. Por último y ya en el siglo XX con la aparición de moléculas tales como estireno, melanina, cloruro de vinilo y poliésteres se comenzó a desarrollar la industria de los polímeros que se añadieron a los morteros dando lugar a los “composites”. El uso de polímeros en matrices cementantes dotan al mortero de propiedades tales como: adherencia, flexibilidad y trabajabilidad, como ya se tiene constancia desde los años 30 con el uso de caucho naturales. En la actualidad el uso de polímeros de síntesis (polivinialacetato, estireno-butadieno, viniacrílico y resinas epoxi) hacen que principalmente el mortero tenga mayor resistencia al ataque del agua y por lo tanto aumente su durabilidad ya que se minimizan todas las reacciones de deterioro (hielo, humedad, ataque biológico,…). En el presente estudio el polímero que se utilizó fue en estado polvo: polímero redispersable. Estos polímeros están encapsulados y cuando se ponen en contacto con el agua se liberan de la cápsula formando de nuevo el gel. En los morteros de reparación el único compuesto hidraúlico que hay es el cemento y es el principal constituyente hoy en día de los materiales de construcción. El cemento se obtiene por molienda conjunta de Clínker y yeso. El Clínker se obtiene por cocción de una mezcla de arcillas y calizas hasta una temperatura de 1450-1500º C por reacción en estado fundente. Para esta reacción se deben premachacar y homogeneizar las materias primas extraídas de la cantera. Son dosificadas en el horno con unas proporciones tales que cumplan con unas relación de óxidos tales que permitan formar las fases anhidras del Clínker C3S, C2S, C3A y C4AF. De la hidratación de las fases se obtiene el gel CSH que es el que proporciona al cemento de sus propiedades. Existe una norma (UNE-EN 197-1) que establece la composición, especificaciones y tipos de cementos que se fabrican en España. La tendencia actual en la fabricación del cemento pasa por el uso de cementos con mayores contenidos de adiciones (cal, puzolana, cenizas volantes, humo de sílice,…) con el objeto de obtener cementos más sostenibles. Otros componentes que influyen en las características de los morteros son: - Áridos. En el desarrollo de los morteros se suelen usar naturales, bien calizos o silícicos. Hacen la función de relleno y de cohesionantes de la matriz cementante. Deben ser inertes - Aditivos. Son aquellos componentes del mortero que son dosificados en una proporción menor al 5%. Los más usados son los superplastificantes por su acción de reductores de agua que revierte en una mayor durabilidad del mortero. Una vez analizada la composición de los morteros, la mejora tecnológica de los mismos está orientada al aumento de la durabilidad de su vida en obra. La durabilidad se define como la capacidad que éste tiene de resistir a la acción del ambiente, ataques químicos, físicos, biológicos o cualquier proceso que tienda a su destrucción. Estos procesos dependen de factores tales como la porosidad del hormigón y de la exposición al ambiente. En cuanto a la porosidad hay que tener en cuenta la distribución de macroporos, mesoporos y microporos de la estructura del hormigón, ya que no todos son susceptibles de que se produzca el transporte de agentes deteriorantes, provocando tensiones internas en las paredes de los mismos y destruyendo la matriz cementante Por otro lado los procesos de deterioro están relacionados con la acción del agua bien como agente directo o como vehículo de transporte del agente deteriorante. Un ambiente que resulta muy agresivo para los hormigones es el marino. En este caso los procesos de deterioro están relacionados con la presencia de cloruros y de sulfatos tanto en el agua de mar como en la atmosfera que en combinación con el CO2 y O2 forman la sal de Friedel. El deterioro de las estructuras en ambientes marinos se produce por la debilitación de la matriz cementante y posterior corrosión de las armaduras que provocan un aumento de volumen en el interior y rotura de la matriz cementante por tensiones capilares. Otras reacciones que pueden producir estos efectos son árido-álcali y difusión de iones cloruro. La durabilidad de un hormigón también depende del tipo de cemento y su composición química (cementos con altos contenidos de adición son más resistentes), relación agua/cemento y contenido de cemento. La Norma UNE-EN 1504 que consta de 10 partes, define los productos para la protección y reparación de estructuras de hormigón, el control de calidad de los productos, propiedades físico-químicas y durables que deben cumplir. En esta Norma se referencian otras 65 normas que ofrecen los métodos de ensayo para la evaluación de los sistemas de reparación. En la segunda parte de esta Tesis se hizo un diseño de experimentos con diferentes morteros poliméricos (con concentraciones de polímero entre 0 y 25%), tomando como referencia un mortero control sin polímero, y se estudiaron sus propiedades físico-químicas, mecánicas y durables. Para mortero con baja proporción de polímero se recurre a sistemas monocomponentes y para concentraciones altas bicomponentes en la que el polímero está en dispersión acuosa. Las propiedades mecánicas medidas fueron: resistencia a compresión, resistencia a flexión, módulo de elasticidad, adherencia por tracción directa y expansión-retracción, todas ellas bajo normas UNE. Como ensayos de caracterización de la durabilidad: absorción capilar, resistencia a carbonatación y adherencia a tracción después de ciclos hielo-deshielo. El objeto de este estudio es seleccionar el mortero con mejor resultado general para posteriormente hacer una comparativa entre un mortero con polímero (cantidad optimizada) y un mortero sin polímero. Para seleccionar esa cantidad óptima de polímero a usar se han tenido en cuenta los siguientes criterios: el mortero debe tener una clasificación R4 en cuanto a prestaciones mecánicas al igual que para evaluar sus propiedades durables frente a los ciclos realizados, siempre teniendo en cuenta que la adición de polímero no puede ser elevada para hacer el mortero competitivo. De este estudio se obtuvieron las siguientes conclusiones generales: - Un mortero normalizado no cumple con propiedades para ser clasificado como R3 o R4. - Sin necesidad de polímero se puede obtener un mortero que cumpliría con R4 para gran parte de las características medidas - Es necesario usar relaciones a:c< 0.5 para conseguir morteros R4, - La adición de polímero mejora siempre la adherencia, abrasión, absorción capilar y resistencia a carbonatación - Las diferentes proporciones de polímero usadas siempre suponen una mejora tecnológica en propiedades mecánicas y de durabilidad. - El polímero no influye sobre la expansión y retracción del mortero. - La adherencia se mejora notablemente con el uso del polímero. - La presencia de polímero en los morteros mejoran las propiedades relacionadas con la acción del agua, por aumento del poder cementante y por lo tanto de la cohesión. El poder cementante disminuye la porosidad. Como consecuencia final de este estudio se determinó que la cantidad óptima de polímero para la segunda parte del estudio es 2.0-3.5%. La tercera parte consistió en el estudio comparativo de dos morteros: uno sin polímero (mortero A) y otro con la cantidad optimizada de polímero, concluida en la parte anterior (mortero B). Una vez definido el porcentaje de polímeros que mejor se adapta a los resultados, se plantea un nuevo esqueleto granular mejorado, tomando una nueva dosificación de tamaños de áridos, tanto para el mortero de referencia, como para el mortero con polímeros, y se procede a realizar los ensayos para su caracterización física, microestructural y de durabilidad, realizándose, además de los ensayos de la parte 1, mediciones de las propiedades microestructurales que se estudiaron a través de las técnicas de porosimetría de mercurio y microscopia electrónica de barrido (SEM); así como propiedades del mortero en estado fresco (consistencia, contenido de aire ocluido y tiempo final de fraguado). El uso del polímero frente a la no incorporación en la formulación del mortero, proporcionó al mismo de las siguientes ventajas: - Respecto a sus propiedades en estado fresco: El mortero B presentó mayor consistencia y menor cantidad de aire ocluido lo cual hace un mortero más trabajable y más dúctil al igual que más resistente porque al endurecer dejará menos huecos en su estructura interna y aumentará su durabilidad. Al tener también mayor tiempo de fraguado, pero no excesivo permite que la manejabilidad para puesta en obra sea mayor, - Respecto a sus propiedades mecánicas: Destacar la mejora en la adherencia. Es una de las principales propiedades que confiere el polímero a los morteros. Esta mayor adherencia revierte en una mejora de la adherencia al soporte, minimización de las posibles reacciones en la interfase hormigón-mortero y por lo tanto un aumento en la durabilidad de la reparación ejecutada con el mortero y por consecuencia del hormigón. - Respecto a propiedades microestructurales: la porosidad del mortero con polímero es menor y menor tamaño de poro critico susceptible de ser atacado por agentes externos causantes de deterioro. De los datos obtenidos por SEM no se observaron grandes diferencias - En cuanto a abrasión y absorción capilar el mortero B presentó mejor comportamiento como consecuencia de su menor porosidad y su estructura microscópica. - Por último el comportamiento frente al ataque de sulfatos y agua de mar, así como al frente de carbonatación, fue más resistente en el mortero con polímero por su menor permeabilidad y su menor porosidad. Para completar el estudio de esta tesis, y debido a la gran importancia que están tomando en la actualidad factores como la sostenibilidad se ha realizado un análisis de ciclo de vida de los dos morteros objeto de estudio de la segunda parte experimental.In recent years, the extended use of repair materials for buildings and structures made the development of repair mortars more and more technical. In the development of these mortars by producers, the use of polymers in the formulations is a key point, because sometimes this use is not justified when looking to the performance/price/application as a whole. This thesis is an exhaustive study to justify the use of these mortars as a response to the current growing demand for structural repair. The thesis is classified in three parts:The first part is the study of the state of the art of mortars and their constituents.In ancient times, widely used mortars were based on lime and gypsum. The Greeks and Romans developed the concept of lime mortars, introducing components such as pozzolans, hydraulic limes and marble dust as aggregates, giving very similar concrete mortars to the ones used currently. In the middle Age and Renaissance, the technology developed by the Romans was lost, due to the extensive use of stone in the civil, religious and defensive constructions. It was not until the 19th century, when J. Aspdin discovered the current cement as the main hydraulic compound. Finally in the 20th century, with the appearance of molecules such as styrene, melanin, vinyl chloride and polyester, the industry began to develop polymers which were added to the binder to form special "composites".The use of polymers in cementitious matrixes give properties to the mortar such as adhesion, Currently, the result of the polymer synthesis (polivynilacetate, styrene-butadiene, vynilacrylic and epoxy resins) is that mortars have increased resistance to water attack and therefore, they increase their durability since all reactions of deterioration are minimised (ice, humidity, biological attack,...). In the present study the polymer used was redispersible polymer powder. These polymers are encapsulated and when in contact with water, they are released from the capsule forming a gel.In the repair mortars, the only hydraulic compound is the cement and nowadays, this is the main constituent of building materials. The current trend is centered in the use of higher contents of additions (lime, pozzolana, fly ash, silica, silica fume...) in order to obtain more sustainable cements. Once the composition of mortars is analyzed, the technological improvement is centred in increasing the durability of the working life. Durability is defined as the ability to resist the action of the environment, chemical, physical, and biological attacks or any process that tends to its destruction. These processes depend on factors such as the concrete porosity and the environmental exposure. In terms of porosity, it be considered, the distribution of Macropores and mesopores and pores of the concrete structure, since not all of them are capable of causing the transportation of damaging agents, causing internal stresses on the same walls and destroying the cementing matrix.In general, deterioration processes are related to the action of water, either as direct agent or as a transport vehicle. Concrete durability also depends on the type of cement and its chemical composition (cement with high addition amounts are more resistant), water/cement ratio and cement content. The standard UNE-EN 1504 consists of 10 parts and defines the products for the protection and repair of concrete, the quality control of products, physical-chemical properties and durability. Other 65 standards that provide the test methods for the evaluation of repair systems are referenced in this standard. In the second part of this thesis there is a design of experiments with different polymer mortars (with concentrations of polymer between 0 and 25%), taking a control mortar without polymer as a reference and its physico-chemical, mechanical and durable properties were studied. For mortars with low proportion of polymer, 1 component systems are used (powder polymer) and for high polymer concentrations, water dispersion polymers are used. The mechanical properties measured were: compressive strength, flexural strength, modulus of elasticity, adhesion by direct traction and expansion-shrinkage, all of them under standards UNE. As a characterization of the durability, following tests are carried out: capillary absorption, resistance to carbonation and pull out adhesion after freeze-thaw cycles. The target of this study is to select the best mortar to make a comparison between mortars with polymer (optimized amount) and mortars without polymer. To select the optimum amount of polymer the following criteria have been considered: the mortar must have a classification R4 in terms of mechanical performance as well as in durability properties against the performed cycles, always bearing in mind that the addition of polymer cannot be too high to make the mortar competitive in price. The following general conclusions were obtained from this study: - A standard mortar does not fulfill the properties to be classified as R3 or R4 - Without polymer, a mortar may fulfill R4 for most of the measured characteristics. - It is necessary to use relations w/c ratio < 0.5 to get R4 mortars - The addition of polymer always improves adhesion, abrasion, capillary absorption and carbonation resistance - The different proportions of polymer used always improve the mechanical properties and durability. - The polymer has no influence on the expansion and shrinkage of the mortar - Adhesion is improved significantly with the use of polymer. - The presence of polymer in mortars improves the properties related to the action of the water, by the increase of the cement power and therefore the cohesion. The cementitious properties decrease the porosity. As final result of this study, it was determined that the optimum amount of polymer for the second part of the study is 2.0 - 3.5%. The third part is the comparative study between two mortars: one without polymer (A mortar) and another with the optimized amount of polymer, completed in the previous part (mortar B). Once the percentage of polymer is defined, a new granular skeleton is defined, with a new dosing of aggregate sizes, for both the reference mortar, the mortar with polymers, and the tests for physical, microstructural characterization and durability, are performed, as well as trials of part 1, measurements of the microstructural properties that were studied by scanning electron microscopy (SEM) and mercury porosimetry techniques; as well as properties of the mortar in fresh State (consistency, content of entrained air and final setting time). The use of polymer versus non polymer mortar, provided the following advantages: - In fresh state: mortar with polymer presented higher consistency and least amount of entrained air, which makes a mortar more workable and more ductile as well as more resistant because hardening will leave fewer gaps in its internal structure and increase its durability. Also allow it allows a better workability because of the longer (not excessive) setting time. - Regarding the mechanical properties: improvement in adhesion. It is one of the main properties which give the polymer to mortars. This higher adhesion results in an improvement of adhesion to the substrate, minimization of possible reactions at the concrete-mortar interface and therefore an increase in the durability of the repair carried out with mortar and concrete. - Respect to microstructural properties: the porosity of mortar with polymer is less and with smaller pore size, critical to be attacked by external agents causing deterioration. No major differences were observed from the data obtained by SEM - In terms of abrasion and capillary absorption, polymer mortar presented better performance as a result of its lower porosity and its microscopic structure. - Finally behavior against attack by sulfates and seawater, as well as to carbonation, was better in the mortar with polymer because of its lower permeability and its lower porosity. To complete the study, due to the great importance of sustainability for future market facts, the life cycle of the two mortars studied was analysed.

Guidelines of natural zeolites characterization for acid mine drainage treatment. Case study Guayaquil, Ecuador

Zeolites constitute one of the less common groups of tectosilicates. Zeoli1es with pores between -2 to 10 A in their structures have strong sorption capacity and are widely used in industrial and municipal operations to eliminate toxic substances. One of the major environmental problems in the mining activity is the treating of acid mine drainage. In this context, it is very important to search alternatives to manage this challenge. One feasible alternative is using zeolitic tuffs. The results of the physical-chemical characterization of zeolitic tuffs are the c1ue lo continue or not with deeper analysis and tests 01 acid mine drainage treatments. The guidelines to reach this purpose are the main goal of this work. Zeolite 1uff samples (named as XB_01 and XB_02) studied in this work were laken rn the Late Cretaceous Coastal Cayo Arch Ecuador, specifically in the Guaraguao River, showing the most important characteristics of heulandite zeolitic tuffs. X-ray powder diffraction (XRD) tests were developed in order to confirm that the samples belong to the heulandite-type zeoli1ic tuffs. Additionally, Thermogravimetric analysis (TG), Inductively coupled plasma-atomic emission spectroscopy (ICP-AES) and X-ray fluorescence (XRF) of the samples was necessary in order to define the Si/Al ratio and the main mineralogical phases. The XB_01 sample shows a higher ratio Si/Al than XB_02 sample. The cation exchange capacity est was the fundamental step to define the potentiality of the zeolite to use in acid mine drainage treatment Three methodologies were employed to determine the cation exchange capacity. The Cuban standard 626 and the ammonium exchange methodologies reflect results more consistent with each other. This is the starting point to continue with deeper studies such as breakthrough curves for heavy metal ions found in acid mine waters.

Purification and characterization of a luminal cholecystokinin-releasing factor from rat intestinal secretion.

Cholecystokinin (CCK) secretion in rats and humans is inhibited by pancreatic proteases and bile acids in the intestine. It has been hypothesized that the inhibition of CCK release caused by pancreatic proteases is due to proteolytic inactivation of a CCK-releasing peptide present in intestinal secretion. To purify the putative luminal CCK-releasing factor (LCRF), intestinal secretions were collected by perfusing a modified Thiry-Vella fistula of jejunum in conscious rats. From these secretions, the peptide was concentrated by ultrafiltration followed by low-pressure reverse-phase chromatography and purified by reverse-phase high-pressure liquid chromatography. Purity was confirmed by high-performance capillary electrophoresis. Fractions were assayed for CCK-releasing activity by their ability to stimulate pancreatic protein secretion when infused into the proximal small intestine of conscious rats. Partially purified fractions strongly stimulated both pancreatic secretion and CCK release while CCK receptor blockade abolished the pancreatic response. Amino acid analysis and mass spectral analysis showed that the purified peptide is composed of 70-75 amino acid residues and has a mass of 8136 Da. Microsequence analysis of LCRF yielded an amino acid sequence for 41 residues as follows: STFWAYQPDGDNDPTDYQKYEHTSSPSQLLAPGDYPCVIEV. When infused intraduodenally, the purified peptide stimulated pancreatic protein and fluid secretion in a dose-related manner in conscious rats and significantly elevated plasma CCK levels. Immunoaffinity chromatography using antisera raised to synthetic LCRF-(1-6) abolished the CCK releasing activity of intestinal secretions. These studies demonstrate, to our knowledge, the first chemical characterization of a luminally secreted enteric peptide functioning as an intraluminal regulator of intestinal hormone release.

Bioactive compounds and physical and chemical characteristics of mini tomatoes: influence of postharvest treatments

Tomatoes are among the most cultivated and used vegetables in the world. They are very succeptible to post harvest losses due to high perishability, therefore the use of postharvest treatments may contribute to conservation of this fruit, however the treatments might affect significantly physico-chemical, sensory and nutritional characteristics of tomatoes. Given the perishability of tomato and the economic importance of small tomato fruits, the purpose of the present study was to determine the effect of gamma radiation, carnauba coating and 1-MCP treatments on tomato fruit quality during storage. The study may be divided into two parts. In the first, mini tomatoes cv. Sweet Grape were harvested at breaker stage, divided into 4 grous and treated with gamma radiation (0.6 kGy), carnauba coating (1 L 1000 kg-1) and 1-MCP (500 nL L-1) and then stored at 25±2°C for 30 days with a control group of tomatoes. In the seconnd part, tomatoes harvested at light-red stage were submitted to the same treatments and storage period. Every 6 days tomatoes were evaluated for color modifications, fruit firmness, souble and total pectin (only for light-red tomatoes), mass loss, titratable acidity (TA), soluble solids (SS), SS/TA ratio, carotenoids profile, formation of lycopene isomers, total phenolic compounds, ascorbic acid and antioxidant capacity. For tomatoes harvested at breaker stage and submitted to the treatments the results showed mass loss was delaying mainly by carnauba wax, and to a lesser extend by 1-MCP. Fruit firmness were better retained for 1-MCP treated fruits and carnauba treatment showed a transient effect in preserving fruit firmness. SS/TA of tomatoes treated with gamma radiation and carnauba presented no differences from control values, and were lower with the application of 1-MCP. Color was negatively affected by 1-MCP and earlier changed (6th day) when gamma radiation was applied. In relation to bioactive compounds of tomatoes harvest at breaker stage, results indicated gamma radiation and 1-MCP decreased the final content of lycopene and produced more (Z)-isomers of lycopene. Gamma radiation also induced a decreased in ?-carotene and an increased in phenolic compounds by the end of storage period. 1-MCP treatment promoted a slow down increase in ascorbic acid content during storage. Antioxidant capacity of the hydrophilic fraction was not dramatically affected by treatments and the lipophilic fraction was lower, especially for 1-MCP fruits. In addition, contents of ?-carotene, lycopene, (Z)-isomers of lycopene, ascorbic acid and antioxidant capacity increased during the period of storage while contents of lutein and phenolic compounds tended to decrease. Regarding tomatoes harvest at light-red stage, the most effective treatments for delaying fruit firmness and mass loss was carnauba and 1-MCP, while gamma radiation was the treatment with higher mass loss and the less fruit firmness, which could be associated with the higher solubilization of pectins promoted by radiation treatment. Color (L* and Hue) was mainly affected by 1-MCP treatment which delayed color development, however, by the end of storage, the values were not different from the other treatments. SS/TA ratio was lower for fruits treated with 1-MCP and TA was not so dramatically affected by treatments. Furthermore, mini tomatoes harvested at light-red stage, demonstrated irradiation induced changes in the final content of lycopene, increasing it, and formed less (13Z)-lycopene, while 1-MCP and carnauba coating slow down the increase in lycopene and slown down the decrease of ascorbic acid and phenolic compounds. Antioxidant capacity of lipophilic fraction was not affected by treatments and the hydrophilic fraction was lower for irradiated fruits only on day 0 as well as phenolic compounds. In the other days, no differences among treatments were observed for hydrophilic antioxidant capacity. Considering the results, the best combination of SS and TA and fruit preservation for mini tomatoes harvest at breaker stage was promoted by carnauba coating, which seems to be the treatment that causes fewer changes in bioactive compounds of breaker tomatoes. However, when mini tomatoes were harvested at light-red stage, SS/TA ratio and color were better and, to preserve the quality of these fruits, besides carnauba coating, 1-MCP also could be indicated

Biodiversity of Archaea and floral of two inland saltern ecosystems in the Alto Vinalopó Valley, Spain

Background. The extraction of salt from seawater by means of coastal solar salterns is a very well-described process. Moreover, the characterization of these environments from ecological, biochemical and microbiological perspectives has become a key focus for many research groups all over the world over the last 20 years. In countries such as Spain, there are several examples of coastal solar salterns (mainly on the Mediterranean coast) and inland solar salterns, from which sodium chloride is obtained for human consumption. However, studies focused on the characterization of inland solar salterns are scarce and both the archaeal diversity and the plant communities inhabiting these environments remain poorly described. Results. Two of the inland solar salterns (termed Redonda and Penalva), located in the Alto Vinalopó Valley (Alicante, Spain), were characterized regarding their geological and physico-chemical characteristics and their archaeal and botanical biodiversity. A preliminary eukaryotic diversity survey was also performed using saline water. The chemical characterization of the brine has revealed that the salted groundwater extracted to fill these inland solar salterns is thalassohaline. The plant communities living in this environment are dominated by Sarcocornia fruticosa (L.) A.J. Scott, Arthrocnemum macrostachyum (Moris) K. Koch, Suaeda vera Forsk. ex Gmelin (Amaranthaceae) and several species of Limonium (Mill) and Tamarix (L). Archaeal diversity was analyzed and compared by polymerase chain reaction (PCR)-based molecular phylogenetic techniques. Most of the sequences recovered from environmental DNA samples are affiliated with haloarchaeal genera such as Haloarcula, Halorubrum, Haloquadratum and Halobacterium, and with an unclassified member of the Halobacteriaceae. The eukaryote Dunaliella was also present in the samples. Conclusions. To our knowledge, this study constitutes the first analysis centered on inland solar salterns located in the southeastern region of Spain. The results obtained revealed that the salt deposits of this region have marine origins. Plant communities typical of salt marshes are present in this ecosystem and members of the Halobacteriaceae family can be easily detected in the microbial populations of these habitats. Possible origins of the haloarchaea detected in this study are discussed.

Ethnobotanical study of the sages used in traditional Valencian medicine and as essential oil: characterization of an endemic Salvia and its contribution to local development

Seven wild and cultivated Salvia species and two Phlomis species, used traditionally in Valencian medicine to treat a variety of external and internal ailments, were studied. New ethnobotanical data are provided, obtained from semistructured interviews with 34 people in the Valencian area. A seasonal characterization of the essential oil of a wild sage, Salvia blancoana Webb & Heldr. subsp. mariolensis Figuerola, by GC-FID and GC-MS was carried out as a means to ensure quality control of endemic traditional species such as this one, which has been commercialized by local industries. A comparison with the essential oil of Salvia lavandulifolia Vahl subsp.lavandulifolia allowed inclusion of the wild sage within the commercial 'Spanish sage' oil.

Caracterização química e isotópica das águas subterrâneas da bacia hidrográfica do Rio Almonda

Relatório de estágio de mestrado, Geologia Aplicada (Hidrogeologia), Universidade de Lisboa, Faculdade de Ciências, 2016

On the active site in H3PW12O40/SiO2 catalysts for fine chemical synthesis

The surface environment and structural evolution of silica supported phosphotungstic acid (H3PW12O40) catalysts have been investigated as a function of acid loading. H3PW12O40 clusters are deposited intact upon the silica surface, adopting a Stranksi-Krastanov growth mode forming a two-dimensional adlayer which saturates at 45wt% acid. Intimate contact with the silica support perturbs the local chemical environment of three tungstate centres, which become inequivalent with those in the remaining cluster, suggesting an adsorption mode involving three terminal W==O groups. Above the monolayer, H3PW12O40 clusters form three-dimensional crystallites with physico-chemical properties indistinguishable from those in the bulk heteropoly acid. These H3PW12O40/SiO2 materials are efficient for the solventless isomerisation of α-pinene under mild reaction conditions. Activity scales directly with the number of accessible perturbed tungstate sites at the silica interface; these are the active species.

Ecosystem structure, nutrient dynamics, and hydrologic relationships in tree islands of the southern Everglades, Florida, USA

Tree islands are an important structural component of many graminoid-dominated wetlands because they increase ecological complexity in the landscape. Tree island area has been drastically reduced with hydrologic modifications within the Everglades ecosystem, yet still little is known about the ecosystem ecology of Everglades tree islands. As part of an ongoing study to investigate the effects of hydrologic restoration on short hydroperiod marshes of the southern Everglades, we report an ecosystem characterization of seasonally flooded tree islands relative to locations described by variation in freshwater flow (i.e. locally enhanced freshwater flow by levee removal). We quantified: (1) forest structure, litterfall production, nutrient utilization, soil dynamics, and hydrologic properties of six tree islands and (2) soil and surface water physico-chemical properties of adjacent marshes. Tree islands efficiently utilized both phosphorus and nitrogen, but indices of nutrient-use efficiency indicated stronger P than N limitation. Tree islands were distinct in structure and biogeochemical properties from the surrounding marsh, maintaining higher organically bound P and N, but lower inorganic N. Annual variation resulting in increased hydroperiod and lower wet season water levels not only increased nitrogen use by tree species and decreased N:P values of the dominant plant species (Chrysobalanus icaco), but also increased soil pH and decreased soil temperature. When compared with other forested wetlands, these Everglades tree islands were among the most nutrient efficient, likely a function of nutrient immobilization in soils and the calcium carbonate bedrock. Tree islands of our study area are defined by: (1) unique biogeochemical properties when compared with adjacent short hydroperiod marshes and other forested wetlands and (2) an intricate relationship with marsh hydrology. As such, they may play an important and disproportionate role in nutrient and carbon cycling in Everglades wetlands. With the loss of tree islands that has occurred with the degradation of the Everglades system, these landscape processes may have been altered. With this baseline dataset, we have established a long-term ecosystem-scale experiment to follow the ecosystem trajectory of seasonally flooded tree islands in response to hydrologic restoration of the southern Everglades.

(Table 1, Page 1046-1047) Chemical composition of iron-manganese concretions from the Indian Ocean recovered by the R/V Vityaz and the R/V Ob

The data given in this and previous communications is insufficient to assess the quantitative role of these supplementary sources in the Indian Ocean, but they do not rule out their local significance. Elucidation of this problem requires further data on the characteristics of the composition and structure of nodules in various different metallogenic regions of the ocean floor. A study of the distribution of ore elements in nodules both depthwise and over the area of the floor together with compilation of the first schematic maps based on the results of analyses of samples from 54 stations) enables us to give a more precise empirical relation between the Mn, Fe, Ni, Cu, and Co contents in Indian Ocean nodules, the manganese ratio and the values of the oxidation potential, which vary regularly with depth. This in turn also enables us to confirm that formation of nodules completes the prolonged process of deposition of ore components from ocean waters, and the complex physico-chemical transformations of sediments in the bottom layer. Microprobe investigation of ore rinds revealed the nonuniform distribution of a num¬ber of elements within them, owing to the capacity of particles of hydrated oxides of manganese and iron to adsorb various elements. High concentration of individual elements is correlated with local sectors of the ore rinds, in which the presence of todorokite, in particular, has been noted. The appearance of this mineral apparently requires elevated Ca, Mg, Na, and K concentrations, because the stable crystalline phase of this specific mineral form of the psilomelane group may be formed when these cations are incorporated into a lattice of the delta-MnO2 type.

Particle characterization at CVAO during the 2007 RHaMBLe intensive

The chemical characterization of filter high volume (HV) and Berner impactor (BI) samples PM during RHaMBLe (Reactive Halogens in the Marine Boundary Layer) 2007 shows that the Cape Verde aerosol particles are mainly composed of sea salt, mineral dust and associated water. Minor components are nss-salts, OC and EC. The influence from the African continent on the aerosol constitution was generally small but air masses which came from south-western Europe crossing the Canary Islands transported dust to the sampling site together with other loadings. The mean mass concentration was determined for PM10 to 17 µg/m**3 from impactor samples and to 24.2 µg/m**3 from HV filter samples. Non sea salt (nss) components of PM were found in the submicron fractions and nitrate in the coarse mode fraction. Bromide was found in all samples with much depleted concentrations in the range 1-8 ng/m**3 compared to fresh sea salt aerosol indicating intense atmospheric halogen chemistry. Loss of bromide by ozone reaction during long sampling time is supposed and resulted totally in 82±12% in coarse mode impactor samples and in filter samples in 88±6% bromide deficits. A chloride deficit was determined to 8% and 1% for the coarse mode particles (3.5-10 µm; 1.2-3.5 µm) and to 21% for filter samples. During 14 May with high mineral dust loads also the maximum of OC (1.71 µg/m**3) and EC (1.25 µg/m**3) was measured. The minimum of TC (0.25 µg/m**3) was detected during the period 25 to 27 May when pure marine air masses arrived. The concentrations of carbonaceous material decrease with increasing particle size from 60% for the ultra fine particles to 2.5% in coarse mode PM. Total iron (dust vs. non-dust: 0.53 vs. 0.06 µg/m**3), calcium (0.22 vs. 0.03 µg/m**3) and potassium (0.33 vs. 0.02 µg/m**3) were found as good indicators for dust periods because of their heavily increased concentration in the 1.2 to 3.5 µm fraction as compared to their concentration during the non-dust periods. For the organic constituents, oxalate (78-151 ng/m**3) and methanesulfonic acid (MSA, 25-100 ng/m**3) are the major compounds identified. A good correlation between nss-sulphate and MSA was found for the majority of days indicating active DMS chemistry and low anthropogenic influences.

Nanotechnology in food industry II: risk assessment and legislation

Currently, there is increasing use of nanomaterials in the food industry thanks to the many advantages offered and make the products that contain them more competitive in the market. Their physicochemical properties often differ from those of bulk materials, which require specialized risk assessment. This should cover the risks to the health of workers and consumers as well as possible environmental risks. The risk assessment methods must go updating due to more widespread use of nanomaterials, especially now that are making their way down to consumer products. Today there is no specific legislation for nanomaterials, but there are several european dispositions and regulations that include them. This review gives an overview of the risk assessment and the existing current legislation regarding the use of nanotechnology in the food industry.

The physico-chemistry of the northern waters of Lake Victoria

In this paper, we try to briefly review the current physico-chemical data pertaining to Northern Lake Victoria which could eventually be used to explain the following:- (a) whether there bas been a change of the dissolved organic nutrient cencentrations when compared with the pre-perch period, (b) the specific point sources of the influent nutrients and other chemicals and how they correlate with changes in algal productivity, and (c) whether the data can contribute to the validation of the Lake Victoria ecological model developed by Jorgensen at al. (1982).

Amidos crioulos: caracterização fundamental e influência de biopolímeros nas propriedades funcionais do amido

O trabalho apresentado nesta tese focou-se no estudo do amido, nomeadamente na avaliação das características físico-químicas, morfológicas, térmicas e reológicas do amido de seis variedades de milho crioulo, preservadas no estado de Santa Catarina (Brasil), com o intuito de contribuir para a valorização e preservação de variedades locais que são cultivadas em sistemas de produção orgânica, também conhecidas como variedades crioulas. Estas sementes são importantes quer para a preservação da biodiversidade quer para os pequenos produtores que as conservam e as produzem fazendo uso de uma agricultura sustentável e independente comercialmente. Para além da caracterização dos amidos crioulos foram também analisadas as alterações que ocorrem nos processos de gelatinização e retrogradação do amido quando realizados na presença de outros biopolímeros, nomeadamente a quitosana e galactomananas. No Capítulo I é apresentada uma breve revisão do conhecimento científico sobre o amido e sobre a quitosana e galactomananas, os outros biopolímeros utilizados. Igualmente é feita uma sucinta abordagem sobre as principais técnicas analíticas que foram utilizadas: reologia fundamental, calorimetria diferencial de varrimento, microscopia eletrónica de varrimento e espectroscopia de infravermelho médio. No capítulo II apresenta-se o isolamento dos amidos das seis variedades de milho crioulo e a sua caracterização junto com um amido comercial usado como modelo de comparação. Os amidos apresentaram genericamente características físicoquímicas semelhantes e o amido extraído das variedades crioulas MT e MPA 01 apresentaram menor temperatura de gelatinização e maior percentagem de retrogradação, respetivamente. Os efeitos da adição da quitosana e de três galactomananas (goma guar, goma de alfarroba e goma cassia) em sistemas mistos com o amido são analisados nos Capítulos III e IV respetivamente. A adição dos biopolímeros aos amidos resultou no aumento das temperaturas de gelatinização, na alteração da retrogradação do amido pelas galactomananas e na alteração das propriedades viscoeláticas dos géis formados. Os dados de infravermelho esclareceram que nos sistemas com quitosana, o amido formou complexos com o ácido acético usado para dissolver a quitosana e que esta por sua vez formou acetato de quitosana. O comportamento durante a gelatinização do amido comercial quando comparado com o amido do milho crioulo MPA na sua interação com as galactomananas é diferenciado.

Valorización simbólica del Queso Crema de Chiapas, un queso mexicano tradicional con calidad de origen

El objetivo de este trabajo consistió en explorar el valor simbólico que posee un queso tradicional mexicano, el Queso Crema de Chiapas. Para ello, se recorrió un largo camino de caracterización técnica de los rasgos fisicoquímicos, microbiológicos y sensoriales del producto, así como también de sus canales de comercialización y su red de valor. Una vez que se conocieron y se identificaron los aspectos tecnológicos mensurables, que imparten las características especiales al Queso Crema de Chiapas. La presente investigación mostró la existencia de aspectos subjetivos que aportan un valor y significado a este queso genuino; aspectos determinados por la sociedad, y en especial por los productores. El simbolismo es un rasgo asignado por las personas; se trata de un concepto subjetivo que está determinado por la necesidade, y fundamentado por la historia, la cultura, la idiosincrasia y su forma de vida. Estos valores favorecen la presencia del queso en el mercado, lo que contribuye a su preservación como patrimonio alimentario. Esta investigación se realizó con un enfoque antropológico, cualitativo-cuantitativo y observacional en campo, que se complementó con investigaciones anteriores, demostrando el valor de este alimento identitario de Chiapas. Sus resultados pueden ser empleados como instrumento para promover acciones de valorización adecuadas y contribuir al desarrollo socioeconómico y cultural de su región de origen.