534 resultados para Doyle, Plínio


Relevância:

10.00% 10.00%

Publicador:

Resumo:

The time is ripe for a comprehensive mission to explore and document Earth's species. This calls for a campaign to educate and inspire the next generation of professional and citizen species explorers, investments in cyber-infrastructure and collections to meet the unique needs of the producers and consumers of taxonomic information, and the formation and coordination of a multi-institutional, international, transdisciplinary community of researchers, scholars and engineers with the shared objective of creating a comprehensive inventory of species and detailed map of the biosphere. We conclude that an ambitious goal to describe 10 million species in less than 50 years is attainable based on the strength of 250 years of progress, worldwide collections, existing experts, technological innovation and collaborative teamwork. Existing digitization projects are overcoming obstacles of the past, facilitating collaboration and mobilizing literature, data, images and specimens through cyber technologies. Charting the biosphere is enormously complex, yet necessary expertise can be found through partnerships with engineers, information scientists, sociologists, ecologists, climate scientists, conservation biologists, industrial project managers and taxon specialists, from agrostologists to zoophytologists. Benefits to society of the proposed mission would be profound, immediate and enduring, from detection of early responses of flora and fauna to climate change to opening access to evolutionary designs for solutions to countless practical problems. The impacts on the biodiversity, environmental and evolutionary sciences would be transformative, from ecosystem models calibrated in detail to comprehensive understanding of the origin and evolution of life over its 3.8 billion year history. The resultant cyber-enabled taxonomy, or cybertaxonomy, would open access to biodiversity data to developing nations, assure access to reliable data about species, and change how scientists and citizens alike access, use and think about biological diversity information.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

Streamwater is affected by several processes in the watershed including anthropogenic activities that result in changes in water quality as well as in the functioning of these stream ecosystems. Therefore, this work aims to evaluate the concentration of major ions (Ca2+, Mg2+, Na+, K+, NH4+, NO3-, NO2-, Cl-, SO4(2-), PO4(3-), HCO3-) in streams in the state of São Paulo (southeast Brazil). The sampling sites are located at undisturbed (ombrophilus dense forest, semideciduous forest and savanna - cerrado) and disturbed areas (pasture, urbanization and sugar cane crops). Streamwater chemistry varied according to land use change and, in general, was higher in disturbed sites. Streams located in undisturbed sites at Ribeira de Iguape/Alto Paranapanema watershed (streams 1, 2 and 3) seem to be regulated by soil characteristics, as the disturbed streams located at the same watershed covered by pasture (stream 7) showed high concentration for the most of the variables. Exception to streams located at Pontal do Paranapanema watershed where both disturbed (stream 8) and undisturbed streams (stream 4 and 5) presented similar patterns for almost all variables measured.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

A matéria orgânica do solo (MOS) é responsável pela fertilidade, ciclagem de nutrientes e estabilidade da estrutura, possuindo estreita relação com a agregação do solo. No entanto, ainda não é clara a relação entre as classes de agregados na dinâmica de acúmulo ou perda de MOS em função do uso e manejo do solo. Este trabalho teve como objetivo avaliar os teores de carbono (C) em agregados do solo sob quatro usos e manejos: Cerrado nativo (CE), sistema plantio direto (SPD), sistema plantio convencional (SPC) e pastagem (PA). As áreas de estudo estão localizadas no município de Rio Verde (GO), em solo classificado como Latossolo Vermelho distrófico de textura argilosa. Em amostras de solo coletadas em fevereiro de 2007 nas camadas de 0-5, 5-10 e 10-20 cm de profundidade, foram determinados: a quantidade de macroagregados (maiores que 2,0 mm), mesoagregados (maiores que 0,25 e menores que 2,00 mm) e microagregados (maiores que 0,05 e menores que 0,25 mm) estáveis em água, os índices de agregação diâmetro médio ponderado (DMP) e geométrico (DMG) e os teores de C nas classes de agregados estabelecidas. No solo avaliado observou-se predominância de macroagregados, com maior quantidade sob CE e PA, em comparação ao solo sob SPD e SPC, indicando efeito negativo do cultivo do solo na conservação de macroagregados. Contudo, os teores de C nos agregados do solo na camada de 0-20 cm foram maiores no CE e SPD em relação a PA e SPC, sugerindo que o não revolvimento e a manutenção dos resíduos culturais na superfície do solo favorecem o acúmulo de C. Com isso, foi verificado que os macro e mesoagregados podem ser mais sensíveis ao tipo de uso e manejo do solo, quando comparados aos microagregados. A agregação do solo sob PA é semelhante à do CE, embora com menores teores de C, sugerindo dinâmica de agregação diferenciada, o que merece a atenção de novas pesquisas.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

We investigated the seasonal patterns of Amazonian forest photosynthetic activity, and the effects thereon of variations in climate and land-use, by integrating data from a network of ground-based eddy flux towers in Brazil established as part of the ‘Large-Scale Biosphere Atmosphere Experiment in Amazonia’ project. We found that degree of water limitation, as indicated by the seasonality of the ratio of sensible to latent heat flux (Bowen ratio) predicts seasonal patterns of photosynthesis. In equatorial Amazonian forests (5◦ N–5◦ S), water limitation is absent, and photosynthetic fluxes (or gross ecosystem productivity, GEP) exhibit high or increasing levels of photosynthetic activity as the dry season progresses, likely a consequence of allocation to growth of new leaves. In contrast, forests along the southern flank of the Amazon, pastures converted from forest, and mixed forest-grass savanna, exhibit dry-season declines in GEP, consistent with increasing degrees of water limitation. Although previous work showed tropical ecosystem evapotranspiration (ET) is driven by incoming radiation, GEP observations reported here surprisingly show no or negative relationships with photosynthetically active radiation (PAR). Instead, GEP fluxes largely followed the phenology of canopy photosynthetic capacity (Pc), with only deviations from this primary pattern driven by variations in PAR. Estimates of leaf flush at three

Relevância:

10.00% 10.00%

Publicador:

Resumo:

The 1916 Easter Rising, an unsuccessful insurrection which resulted in the Irish War of Independence, generated a deep change in the political landscape in Ireland. The purpose of this work is to describe this crucial period in the history of Ireland through the voices of Irish writers who expressed their ideas and feelings about the way Ireland was close to gaining its independence. Thanks to songs, poems and literature, I analysed the events of that period through the eyes of the Irish people. Authors like Roddy Doyle and William Butler Yeats were fundamental in examining this topic very thoroughly. Through their works, they were able to convey their knowledge about the events of those years and, at the same time, to give their own opinion, as Irish people, on the topic.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

This study aimed at developing a murine model of surgically induced acute aortic dissection type A for investigation of the formation and progression of acute aortic dissection and to test whether this system could be used for biomarker discovery.

Relevância:

10.00% 10.00%

Publicador:

Relevância:

10.00% 10.00%

Publicador:

Resumo:

Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 +/- 0.3 microM. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

Nitration of tyrosine residues has been observed during various acute and chronic inflammatory diseases. However, the mechanism of tyrosine nitration and the nature of the proteins that become tyrosine nitrated during inflammation remain unclear. Here we show that eosinophils but not other cell types including neutrophils contain nitrotyrosine-positive proteins in specific granules. Furthermore, we demonstrate that the human eosinophil toxins, eosinophil peroxidase (EPO), major basic protein, eosinophil-derived neurotoxin (EDN) and eosinophil cationic protein (ECP), and the respective murine toxins, are post-translationally modified by nitration at tyrosine residues during cell maturation. High resolution affinity-mass spectrometry identified specific single nitration sites at Tyr349 in EPO and Tyr33 in both ECP and EDN. ECP and EDN crystal structures revealed and EPO structure modeling suggested that the nitrated tyrosine residues in the toxins are surface exposed. Studies in EPO(-/-), gp91phox(-/-), and NOS(-/-) mice revealed that tyrosine nitration of these toxins is mediated by EPO in the presence of hydrogen peroxide and minute amounts of NOx. Tyrosine nitration of eosinophil granule toxins occurs during maturation of eosinophils, independent of inflammation. These results provide evidence that post-translational tyrosine nitration is unique to eosinophils.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

The primary goal of this project was to launch a pilot population study in the spring-fed wetland area southwest of Montana Tech to establish baseline data on density, distribution, abundance, and diversity of amphibians in the area. The current confirmed species at the select site is the Columbia spotted frog (Rana luteiventris). Based on preliminary habitat assessment and existing literature, other species possibilities included the long-toed salamander (Ambrystoma macrodactylum) boreal chorus frog (Pseudacris maculata), the Rocky Mountain tailed frog (Ascaphus montanus), and the leopard frog (Rana pipiens), (Werner et al. 2004) though the latter species is considered unlikely based on the specie’s declining status (Werner 2003; Werner et al. 2004). The project’s secondary goal was to collect basic habitat and environmental data: vegetation, precipitation, temperature. The third goal was to explore correlations between species prevalence and environmental data to expand the scientific understanding of population dynamics in the field of amphibian studies (see: Ferner, 2007; Dodd, 2010).

Relevância:

10.00% 10.00%

Publicador:

Relevância:

10.00% 10.00%

Publicador:

Resumo:

This work presents the proceedings of the twelfth symposium which was held at Kansas State University on April 24, 1982. Since a number of the contributions will be published in detail elsewhere, only brief reports are included here. Some of the reports describe current progress with respect to ongoing projects. Requests for further information should be directed to Dr. Peter Reilly at Iowa State University, Dr. V. G. Murphy at Colorado State University, Dr. Rakesh Bajpai at University of Missouri, Dr. Ed Clausen at University of Arkansas, Dr. L. T. Fan and Dr. L. E. Erickson at Kansas State University. ContentsA Kinetic Analysis of Oleaginous Yeast Fermentation by Candida curvata on Whey Permeate, B.D. Brown and K.H. Hsu, Iowa State University Kinetics of Biofouling in Simulated Water Distribution Systems Using CSTR, T.M. Prakash, University of Missouri Kinetics of Gas Production by C. acetobutylicum, Michael Doremus, Colorado State University Large Scale Production of Methane from Agricultural Residues, O.P. Doyle, G.C. Magruder, E.C. Clausen, and J.L. Gaddy, University of Arkansas The Optimal Process Design for Enzymatic Hydrolysis of Wheat Straw, M.M Gharpuray and L.T. Fan, Kansas State University Extractive Butanol Fermentation, Michael Sierks, Colorado State University Yields Associated with Ethyl Alcohol Production, M.D. Oner, Kansas State University Estimation of Growth Yield and Maintenance Parameters for Microbial Growth on Corn Dust, B.O. Solomon, Kansas State University Milling of Ensiled Corn, Andrzej Neryng, Iowa State University Protein Extraction from Alfalfa, Ravidranath Joshi, Colorado State University Analysis of Disaccharides by Capillary Gas Chromatography, Z.L. Nikolov, Iowa State University Characterization of High Viscosity Fermentations in Tower Fermentors, S.A. Patel and C.H. Lee, Kansas State University Utilization of Sugars in Sorghum Molasses by Clostridium acetobutylicum B. Hong, K.C. Shin, and L.T. Fan, Kansas State University

Relevância:

10.00% 10.00%

Publicador:

Resumo:

Background: Evaluation of health-related quality of life (HRQL) is important in improving the quality of patient care. The aim of this study was to determine the psychometric properties of the HeartQoL in patients with ischemic heart disease (IHD), specifically angina, myocardial infarction (MI), or ischemic heart failure. Methods: Data for the interim validation of the HeartQoL questionnaire were collected in (a) a cross-sectional survey and (b) a prospective substudy of patients undergoing either a percutaneous coronary intervention (PCI) or referred to cardiac rehabilitation (CR) and were then analyzed to determine the reliability, validity, and responsiveness of the HeartQoL questionnaire. Results: We enrolled 6384 patients (angina, n = 2111, 33.1%; MI, n = 2351, 36.8%; heart failure, n = 1922, 30.1%) across 22 countries speaking 15 languages in the cross-sectional study and 730 patients with IHD in the prospective substudy. The HeartQoL questionnaire comprises 14-items with physical and emotional subscales and a global score (range 0–3 (poor to better HRQL). Cronbach’s α was consistently ≥0.80; convergent validity correlations between similar HeartQoL and SF-36 subscales were significant (r ≥ 0.60, p < 0.001); discriminative validity was confirmed with predictor variables: health transition, anxiety, depression, and functional status. HeartQoL score changes following either PCI or CR were significant (p < 0.001) with effect sizes ranging from 0.37–0.64. Conclusion: The HeartQoL questionnaire is reliable, valid, and responsive to change allowing clinicians and researchers to (a) assess baseline HRQL, (b) make between-diagnosis comparisons of HRQL, and (c) evaluate change in HRQL in patients with angina, MI, or heart failure with a single IHD-specific HRQL instrument.

Relevância:

10.00% 10.00%

Publicador:

Resumo:

Background: Evaluation of health-related quality of life (HRQL) is important in improving the quality of patient care. Methods: The HeartQoL Project, with cross-sectional and longitudinal phases, was designed to develop a core ischemic heart disease (IHD) specific HRQL questionnaire, to be called the HeartQoL, for patients with angina, myocardial infarction (MI), or ischemic heart failure. Patients completed a battery of questionnaires and Mokken scaling analysis was used to identify items in the HeartQoL questionnaire. Results: We enrolled 6384 patients (angina, n = 2111, 33.1%; MI, n = 2351, 36.8%; heart failure, n = 1922, 30.1%) across 22 countries and 15 languages. The HeartQoL questionnaire comprises 14-items with 10-item physical and 4-item emotional subscales which are scored from 0 (poor HRQL) to 3 (better HRQL) with a global score if needed. The mean baseline HeartQoL global score was 2.2 (±0.5) in the total group and was different (p < 0.001) by diagnosis (MI, 2.4 ± 0.5; angina, 2.2 ± 0.6; and heart failure, 2.1 ± 0.6). Conclusion: The HeartQoL questionnaire, with global and subscale scores, has the potential to allow clinicians and researchers to (a) assess baseline HRQL, (b) make between-diagnosis comparisons of HRQL, and (c) evaluate change in HRQL in patients with angina, MI, or heart failure with a single IHD-specific HRQL instrument.