982 resultados para liquid characterization


Relevância:

30.00% 30.00%

Publicador:

Resumo:

This letter presents a novel temperature sensor, which consists of an interdigitated comb electrode structure with a micrometric-scale size, nanometric metallic layer, and nematic liquid crystal (NLC) film. This sensor exploits the permittivity dependence of the NLC with temperature and principle of electrical conductivity above the percolation threshold in thin film metallic layers. The latter has been demonstrated to increase the temperature sensitivity considerably. The high impedance input reduces the power dissipation, and the high enough voltage output makes it easy to measure the output signal with high precision. The operation principle and fabrication process as well as the characterization of the temperature sensor are presented. Experimental results show that the device offers a sensitivity of 9 mV/°C and is dependent on the applied voltage. This is six times greater than the same structure without the use of a nanometric layer.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

In recent years, many experimental and theoretical research groups worldwide have actively worked on demonstrating the use of liquid crystals (LCs) as adaptive lenses for image generation, waveform shaping, and non-mechanical focusing applications. In particular, important achievements have concerned the development of alternative solutions for 3D vision. This work focuses on the design and evaluation of the electro-optic response of a LC-based 2D/3D autostereoscopic display prototype. A strategy for achieving 2D/3D vision has been implemented with a cylindrical LC lens array placed in front of a display; this array acts as a lenticular sheet with a tunable focal length by electrically controlling the birefringence. The performance of the 2D/3D device was evaluated in terms of the angular luminance, image deflection, crosstalk, and 3D contrast within a simulated environment. These measurements were performed with characterization equipment for autostereoscopic 3D displays (angular resolution of 0.03 ).

Relevância:

30.00% 30.00%

Publicador:

Resumo:

In this paper, the design and experimental characterization of a tunable microstrip bandpass filter based on liquid crystal technology are presented. A reshaped microstrip dual-mode filter structure has been used in order to improve the device performance. Specifically, the aim is to increase the pass-band return loss of the filter by narrowing the filter bandwidth. Simulations confirm the improvement of using this new structure, achieving a pass-band return loss increase of 1.5 dB at least. Because of the anisotropic properties of LC molecules, a filter central frequency shift from 4.688 GHz to 5.045 GHz, which means a relative tuning range of 7.3%, is measured when an external AC voltage from 0 Vrms to 15 Vrms is applied to the device.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

El presente trabajo de Tesis se ha centrado en el diseño, fabricación y caracterización de dispositivos basados en fibras de cristal fotónico infiltrado selectivamente con cristales líquidos, polímeros y una mezcla de ambos. Todos los dispositivos son sintonizables, y su área de aplicación se centra en comunicaciones ópticas y sensores. La manipulación y fusionado de fibras fotónicas, el llenado selectivo de determinadas cavidades y la alineación recíproca de fibras mantenedoras de polarización son tareas muy específicas y delicadas para las que se requieren protocolos muy estrictos. Previo a la fabricación de dispositivos ha sido necesaria por tanto una tarea de sistematización y creación de protocolos de fabricación. Una vez establecidos se ha procedido a la fabricación y caracterización de dispositivos. Los dispositivos fabricados se enumeran a continuación para posteriormente detallar una a una las singularidades de cada uno. • Interferómetros intermodales hechos a partir de una porción de fibra fotónica soldada entre dos fibras estándar, bien monomodo o PANDA (mantenedora de polarización). Estos interferómetros han sido sumergidos o bien llenados selectivamente con cristales líquidos para así sintonizar la señal interferométrica guiada a través de la fibra. • Infiltración de fibras fotónicas con cristales líquidos colestéricos con especial énfasis en la fase azul (blue phase) de estos materiales. Las moléculas de cristal líquido se autoalinean en volumen por lo que la infiltración de fibras fotónicas con estos cristales líquidos es muy interesante, pues es conocida la dificultad de alinear apropiadamente cristales líquidos dentro de cavidades micrométricas de las fibras fotónicas. • Grabación de redes holográficas de forma selectiva en las cavidades de una fibra fotónica. Estas redes holográficas, llamadas POLICRYPS (POlymer-LIquid CRYstal-Polymer Slices), son redes fabricadas a base de franjas de polímero y cristal líquido alineado perpendicularmente a dichas franjas. Las franjas son a su vez perpendiculares al eje de la fibra como lo puede ser una red de Bragg convencional. El cristal líquido, al estar alineado perpendicularmente a dichos franjas y paralelo al eje de la fibra, se puede conmutar aplicando un campo eléctrico externo, modificando así el índice efectivo de la red. Se puede fabricar por lo tanto una red de Bragg sintonizable en fibra, muy útil en comunicaciones ópticas. • Llenado selectivo de fibras fotónicas con polidimetilsiloxano (PDMS), un polímero de tipo silicona. Si se realiza un llenado selectivo asimétrico se puede inducir birrefringencia en la fibra. El índice de refracción del PDMS tiene una fuerte dependencia térmica, por lo que se puede sintonizar la birrefringencia de la fibra. • Estudio teórico de llenado selectivo de fibras fotónicas con PDMS dopado con nanopartículas de plata de 5, 40 y 80 nm. Estas nanopartículas poseen un pico de absorción en torno a los 450 nm debido a resonancias superficiales localizadas de plasmones (LSPR). La resonancia del plasmon tiene una fuerte dependencia con el índice de refracción del material colindante, y al ser éste PDMS, la variación de índice de refracción se ve amplificada, obteniendo una absorción sintonizable. Se ha propuesto la fabricación de polarizadores sintonizables usando esta técnica. Como ya se ha dicho, previamente a la fabricación ha sido necesaria la protocolización de diversos procedimientos de fabricación de alta complejidad, así como protocolizar el proceso de toma de medidas para optimizar los resultados. Los procedimientos que han requerido la formulación de protocolos específicos han sido los siguientes: • Llenado selectivo de cavidades en una fibra fotónica. Dichas fibras tienen generalmente un diámetro externo de 125 μm, y sus cavidades son de entre 5 y 10 μm de diámetro. Se han desarrollado tres técnicas diferentes para el llenado/bloqueado selectivo, pudiéndose combinar varios protocolos para la optimización del proceso. Las técnicas son las siguientes: o Llenado y bloqueado con un prepolímero. Dicho prepolímero, también llamado adhesivo óptico, está inicialmente en estado líquido y posee una cierta viscosidad. Las cavidades de la fibra fotónica que se desea llenar o bloquear poseen un diámetro diferente al resto, por lo que en el proceso de llenado aparecen dos frentes de llenado dependientes de su diámetro. A mayor diámetro, mayor velocidad de llenado. Polimerizando cuando existe dicha diferencia en los frentes se puede cortar por medio, obteniendo así una fibra parcialmente bloqueada. o Colapsamiento de las cavidades de menor diámetro mediante aplicación de calor. El calor producido por un arco voltaico de una soldadora de fibra estándar fusiona el material exterior de la fibra produciendo el colapsamiento de las cavidades de menor diámetro. En esta técnica también es necesaria una diferencia de diámetros en las cavidades de la fibra. o Bloqueo una a una de las cavidades de la fibra fotónica con adhesivo óptico. Este procedimiento es muy laborioso y requiere mucha precisión. Con este sistema se pueden bloquear las cavidades deseadas de una fibra sin importar su diámetro. • Alineación de una fuente de luz linealmente polarizada con una fibra mantenedora de polarización ya sea PANDA o fotónica. Así mismo también se han alineado entre sí fibras mantenedoras de polarización, para que sus ejes rápidos se fusionen paralelos y así el estado de polarización de la luz guiada se mantenga. • Sistematización de toma de medidas para caracterizar los interferómetros modales. Éstos son altamente sensibles a diversas variables por lo que el proceso de medida es complejo. Se deben aislar variables de forma estrictamente controlada. Aunque todos los dispositivos tienen en común el llenado selectivo de cavidades en una fibra fotónica cada dispositivo tiene sus peculiaridades, que van a ser explicadas a continuación. ABSTRACT The present Thesis has been centered in the design, fabrication and characterization of devices based on photonic crystal fibers selectively filled with liquid crystals, polymers and a mixture of both. All devices are tunable and their work field is optical communications and sensing The handling and splicing of photonic crystal fibers, the selective filling of their holes and the aligning of polarization maintaining fibers are very specific and delicate tasks for which very strict protocols are required. Before the fabrication of devices has therefore been necessary task systematization and creation of manufacturing protocols. Once established we have proceeded to the fabrication and characterization of devices. The fabricated devices are listed below and their peculiarities are detailed one by one: • Intermodal interferometers made with a portion of photonic crystal fiber spliced between two optical communication fiber pigtails, either single mode or PANDA (polarization-maintaining) fiber. These interferometers have been submerged or selectively filled with liquid crystals to tune the interferometric guided signal. • Infiltration of photonic fibers with cholesteric liquid crystals with special emphasis on their blue phase (blue phase). The liquid crystal molecules are self-aligning in volume so the infiltration of photonic fibers with these liquid crystals is very interesting. It is notoriously difficult to properly align liquid crystals within micron cavities such as photonic fibers. • Selectively recording of holographic gratings in the holes of photonic crystal fibers. These holographic gratings, called POLICRYPS (POlymer-LIquid CRYstal-Polymes Slices), are based on walls made of polymer and liquid crystal aligned perpendicular to them. These walls are perpendicular to the axis of the fiber as it can be a conventional Bragg grating. The liquid crystal is aligned perpendicular to the walls and parallel to the fiber axis, and can be switched by applying an external electric field and thus change the effective index of the grating. It is thus possible to manufacture a tunable Bragg grating fiber, useful in optical communications. •Asymmetrically selective filling of photonic crystal fibers with a silicone polymer like called polydimethylsiloxane (PDMS) to induce birefringence in the fiber. The refractive index of PDMS has temperature dependence, so that the birefringence of the fiber can be tuned. • Theoretical study of photonic crystal fibers selectively filled with PDMS doped with silver nanoparticles of 5, 40 and 80 nm. These nanoparticles have an absorption peak around 450 nm due to localized surface plasmon resonances (LSPR). Plasmon resonance has a strong dependence on the refractive index of the adjacent material, and as this is PDMS, the refractive index variation is amplified, obtaining a tunable absorption. Fabrication of tunable polarizers using this technique has been proposed. Before starting the fabrication, it has been necessary to optimize several very delicate procedures and different protocols have been designed. The most delicate procedures are as follows: • Selective filling of holes in a photonic crystal fiber. These fibers generally have an outer diameter of 125 μm, and their holes have a diameter around between 5 and 10 μm. It has been developed three different techniques for filling / selective blocking, and they can be combined for process optimization. The techniques are: o Filling and blocked with a prepolymer. This prepolymer also called optical adhesive is initially in liquid state and has a certain viscosity. The holes of the photonic crystal fiber that are desired to be filled or blocked should have a different diameter, so that in the filling process appear two different fronts depending on the hole diameter. The holes with larger diameter are filled faster. Then the adhesive is polymerized when there is such a difference on the front. A partially blocked fiber is obtained cutting between fronts. o Collapsing of holes of smaller diameter by application of heat. The heat produced by an arc of a standard fusion splicer fuses the outer fiber material producing the collapsing of the cavities of smaller diameter. In this technique also you need a difference of diameters in the fiber holes. o Blocking one by one the holes of photonic crystal fiber with optical adhesive. This procedure is very laborious and requires great precision. This system can block unwanted cavities regardless fiber diameter. • Aligning a linearly polarized light source with a polarization-maintaining fiber (either a PANDA fiber as a photonic crystal fiber). It is needed also an aligning between polarization-maintaining fibers, so that their fast axes parallel merge and that is state of polarization of light guided is maintained. • Systematization of taking measurements to characterize the modal interferometers. These are highly sensitive to several variables so the measurement process is very complicated. Variables must be fixed in a very controlled manner. Although all devices have the common characteristic of being selectively filled PCFs with some kind of material, each one has his own peculiarities, which are explained below.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

El trabajo contenido en esta tesis doctoral está encuadrado en el desarrollo de antenas reconfigurables electrónicamente capaces de proporcionar prestaciones competitivas a las aplicaciones cada vez más comunes que operan a frecuencias superiores a 60 GHz. En concreto, esta tesis se centra en el estudio, diseño, e implementación de las antenas reflectarray, a las que se introduce la tecnología de cristal líquido como elemento característico con el que se consigue reconfigurabilidad de haz de forma electrónica. Desde un punto de vista muy general, se puede describir un cristal líquido como un material cuya permitividad eléctrica es variable y controlada por una excitación externa, que generalmente suele corresponderse con un campo eléctrico quasi-estático (AC). Las antenas reflectarray de cristal líquido se han escogido como objeto de estudio por varias razones. La primera de ellas tiene que ver con las ventajas que los reflectarrays, y en especial aquellos realizados en configuración planar, proporcionan con respecto a otras antenas de alta ganancia como los reflectores o los “phased-arrays”. En los reflectarrays, la alimentación a través de una fuente primaria común (característica de reflectores) y el elevado número de grados de libertad de las celdas que los componen (característica de arrays) hacen que estas antenas puedan proporcionar prestaciones eléctricas iguales o mejores que las anteriores, a un coste más reducido y con estructuras de antena más compactas. La segunda razón radica en la flexibilidad que ofrece el cristal líquido a ser confinado y polarizado en recintos de geometría variada, como consecuencia de su fluidez (propiedad de los líquidos). Por ello, la tecnología de cristal líquido permite que el propio elemento reconfigurable en las celdas de reflectarray se adapte a la configuración planar de manera que en sí mismo, el cristal líquido sea una o varias de las capas características de esta configuración. Esto simplifica de forma drástica la estructura y la fabricación de este tipo de antenas, incluso si se comparan con reflectarrays reconfigurables basados en otras tecnologías como diodos, MEMS, etc. Por tanto, su coste y desarrollo es muy reducido, lo que hace que se puedan fabricar reflectarrays reconfigurables eléctricamente grandes, a bajo coste, y en producción elevada. Un ejemplo claro de una estructura similar, y que ha tenido éxito comercial, son las pantallas de cristal líquido. La tercera razón reside en el hecho de que el cristal líquido es, hasta la fecha, de las pocas tecnologías capaces de ofrecer reconfigurabilidad del haz a frecuencias superiores a 60 GHz. De hecho, el cristal líquido permite reconfigurabilidad en un amplio margen de frecuencias, que va desde DC a frecuencias del espectro visible, incluyendo las microondas y los THz. Otras tecnologías, como los materiales ferroeléctricos, el grafeno o la tecnología CMOS “on chip” permiten también conmutar el haz en estas frecuencias. Sin embargo, la tecnología CMOS tiene un elevado coste y actualmente está limitada a frecuencias inferiores a 150 GHz, y aunque los materiales ferroeléctricos o el grafeno puedan conmutar a frecuencias más altas y en un rango más amplio, tienen serias dificultades que los hacen aún inmaduros. En el caso de los materiales ferroeléctricos, los elevados voltajes para conmutar el material los hacen poco atractivos, mientras que en el caso del grafeno, su modelado aún está en discusión, y todavía no se han arrojado resultados experimentales que validen su idoneidad. Estas tres razones hacen que los reflectarrays basados en cristal líquido sean atractivos para multitud de aplicaciones de haz reconfigurable a frecuencias superiores a 60 GHz. Aplicaciones como radar de escaneo de imágenes de alta resolución, espectroscopia molecular, radiómetros para observación atmosférica, o comunicaciones inalámbricas de alta frecuencia (WiGig) son algunas de ellas. La tesis está estructurada en tres partes. En la primera de ellas se describen las características más comunes de los cristales líquidos, centrándonos en detalle en aquellas propiedades ofrecidas por este material en fase nemática. En concreto, se estudiará la anisotropía dieléctrica (Ae) de los cristales líquidos uniaxiales, que son los que se emplean en esta tesis, definida como la diferencia entre la permitividad paralela (£//) y la perpendicular (e±): Ae = e,, - e±. También se estudiará la variación de este parámetro (Ae) con la frecuencia, y el modelado electromagnético macroscópico más general que, extraído a partir de aquella, permite describir el cristal líquido para cada tensión de polarización en celdas de geometría planar. Este modelo es de suma importancia para garantizar precisión en el desfasaje proporcionado por las diferentes celdas reconfigurables para reflectarrays que se describirán en la siguiente parte de la tesis. La segunda parte de la tesis se centra en el diseño de celdas reflectarray resonantes basadas en cristal líquido. La razón por la que se escogen estos tipos de celdas reside en el hecho de que son las únicas capaces de proporcionar rangos de fase elevados ante la reducida anisotropía dieléctrica que ofrecen los cristales líquidos. El objetivo de esta parte trata, por tanto, de obtener estructuras de celdas reflectarray que sean capaces de proporcionar buenas prestaciones eléctricas a nivel de antena, mejorando sustancialmente las prestaciones de las celdas reportadas en el estado del arte, así como de desarrollar una herramienta de diseño general para aquellas. Para ello, se estudian las prestaciones eléctricas de diferentes tipos de elementos resonantes de cristal líquido que van, desde el más sencillo, que ha limitado el estado de la técnica hasta el desarrollo de esta tesis y que está formado por un sólo resonador, a elementos que constan de varios resonadores (multi-resonantes) y que pueden ser monocapa o multicapa. En un primer paso, el procedimiento de diseño de estas estructuras hace uso de un modelo convencional de cristal líquido que ha venido siendo usado en el estado del arte para este tipo de celdas, y que considera el cristal líquido como un material homogéneo e isótropo cuya permitividad varía entre (e/7) y (e±). Sin embargo, en esta parte de la tesis se demuestra que dicho modelado no es suficiente para describir de forma genérica el comportamiento del cristal líquido en las celdas tipo reflectarray. En la tesis se proponen procedimientos más exactos para el análisis y diseño basados en un modelo más general que define el cristal líquido como un material anisótropo e inhomogeneo en tres dimensiones, y se ha implementado una técnica que permite optimizar celdas multi-resonantes de forma eficiente para conseguir elevadas prestaciones en cuanto a ancho de banda, rango de fase, pérdidas, o sensibilidad al ángulo de incidencia. Los errores cometidos en el uso del modelado convencional a nivel de celda (amplitud y fase) se han analizado para varias geometrías, usando medidas de varios prototipos de antena que usan un cristal líquido real a frecuencias superiores a 100 GHz. Las medidas se han realizado en entorno periódico mediante un banco cuasi-óptico, que ha sido diseñado especialmente para este fin. Uno de estos prototipos se ha optimizado a 100 GHz para conseguir un ancho de banda relativamente elevado (10%), pérdidas reducidas, un rango de fase mayor de 360º, baja sensibilidad al ángulo de incidencia, y baja influencia de la inhomogeneidad transversal del cristal líquido en la celda. Estas prestaciones a nivel de celda superan de forma clara aquellas conseguidas por otros elementos que se han reportado en la literatura, de manera que dicho prototipo se ha usado en la última parte de la tesis para realizar diversas antenas de barrido. Finalmente, en esta parte se presenta una estrategia de caracterización de la anisotropía macroscópica a partir de medidas de los elementos de reflectarray diseñados en banco cuasi-óptico, obteniendo resultados tanto en las frecuencias de interés en RF como en AC, y comparándolas con aquellas obtenidas mediante otros métodos. La tercera parte de la tesis consiste en el estudio, diseño, fabricación y medida de antenas reconfigurables basadas en cristal líquido en configuraciones complejas. En reflectarrays pasivos, el procedimiento de diseño de la antena se limita únicamente al ajuste en cada celda de la antena de las dimensiones de las metalizaciones que se emplean para el control de fase, mediante procesos de optimización bien conocidos. Sin embargo, en el caso de reflectarrays reconfigurables basados en cristal líquido, resulta necesario un paso adicional, que consiste en calcular de forma adecuada las tensiones de control en cada celda del reflectarray para configurar la fase requerida en cada una de ellas, así como diseñar la estructura y los circuitos de control que permitan direccionar a cada elemento su tensión correspondiente. La síntesis de tensiones es por tanto igual o más importante que el diseño de la geometría de las celdas, puesto que éstas son las que están directamente relacionadas con la fase. En el estado del arte, existen varias estrategias de síntesis de tensiones que se basan en la caracterización experimental de la curva de fase respecto al voltaje. Sin embargo, esta caracterización sólo puede hacerse a un solo ángulo de incidencia y para unas determinadas dimensiones de celda, lo que produce que las tensiones sintetizadas sean diferentes de las adecuadas, y en definitiva que se alcancen errores de fase mayores de 70º. De esta forma, hasta la fecha, las prestaciones a nivel de antena que se han conseguido son reducidas en cuanto a ancho de banda, rango de escaneo o nivel de lóbulos secundarios. En esta última parte de la tesis, se introduce una nueva estrategia de síntesis de tensiones que es capaz de predecir mediante simulaciones, y con alta precisión, las tensiones que deben introducirse en cada celda teniendo en cuenta su ángulo de incidencia, sus dimensiones, la frecuencia, así como la señal de polarización definida por su frecuencia y forma de onda AC. Esta estrategia se basa en modelar cada uno de los estados de permitividad del cristal líquido como un sustrato anisótropo con inhomogeneidad longitudinal (1D), o en ciertos casos, como un tensor equivalente homogéneo. La precisión de ambos modelos electromagnéticos también se discute. Con el objetivo de obtener una herramienta eficiente de cálculo de tensiones, también se ha escrito e implementado una herramienta de análisis basada en el Método de los Momentos en el Dominio Espectral (SD-MoM) para sustratos estratificados anisótropos, que se usa en cada iteración del procedimiento de síntesis para analizar cada una de las celdas de la antena. La síntesis de tensiones se ha diseñado además para reducir al máximo el efecto del rizado de amplitud en el diagrama de radiación, que es característico en los reflectarrays que están formados por celdas con pérdidas elevadas, lo que en sí, supone un avance adicional para la obtención de mejores prestaciones de antena. Para el cálculo de los diagramas de radiación empleados en el procedimiento de síntesis, se asume un análisis elemento a elemento considerando periodicidad local, y se propone el uso de un método capaz de modelar el campo incidente de forma que se elimine la limitación de la periodicidad local en la excitación. Una vez definida la estrategia adecuada de cálculo de las tensiones a aplicar al cristal líquido en cada celda, la estructura de direccionamiento de las mismas en la antena, y diseñados los circuitos de control, se diseñan, fabrican y miden dos prototipos diferentes de antena de barrido electrónico a 100 GHz usando las celdas anteriormente presentadas. El primero de estos prototipos es un reflectarray en configuración “single offset” con capacidad de escaneo en un plano (elevación o azimut). Aunque previamente se realizan diseños de antenas de barrido en 2D a varias frecuencias en el rango de milimétricas y sub-milimétricas, y se proponen ciertas estrategias de direccionamiento que permiten conseguir este objetivo, se desarrolla el prototipo con direccionamiento en una dimensión con el fin de reducir el número de controles y posibles errores de fabricación, y así también validar la herramienta de diseño. Para un tamaño medio de apertura (con un numero de filas y columnas entre 30 y 50 elementos, lo que significa un reflectarray con un número de elementos superior a 900), la configuración “single offset” proporciona rangos de escaneo elevados, y ganancias que pueden oscilar entre los 20 y 30 dBi. En concreto, el prototipo medido proporciona un haz de barrido en un rango angular de 55º, en el que el nivel de lóbulos secundarios (SLL) permanece mejor de -13 dB en un ancho de banda de un 8%. La ganancia máxima es de 19.4 dBi. Estas prestaciones superan de forma clara aquellas conseguidas por otros autores. El segundo prototipo se corresponde con una antena de doble reflector que usa el reflectarray de cristal líquido como sub-reflector para escanear el haz en un plano (elevación o azimut). El objetivo básico de esta geometría es obtener mayores ganancias que en el reflectarray “single offset” con una estructura más compacta, aunque a expensas de reducir el rango de barrido. En concreto, se obtiene una ganancia máxima de 35 dBi, y un rango de barrido de 12º. Los procedimientos de síntesis de tensiones y de diseño de las estructuras de las celdas forman, en su conjunto, una herramienta completa de diseño precisa y eficiente de antenas reflectarray reconfigurables basados en cristales líquidos. Dicha herramienta se ha validado mediante el diseño, la fabricación y la medida de los prototipos anteriormente citados a 100 GHz, que consiguen algo nunca alcanzado anteriormente en la investigación de este tipo de antenas: unas prestaciones competitivas y una predicción excelente de los resultados. El procedimiento es general, y por tanto se puede usar a cualquier frecuencia en la que el cristal líquido ofrezca anisotropía dieléctrica, incluidos los THz. Los prototipos desarrollados en esta tesis doctoral suponen también unas de las primeras antenas de barrido real a frecuencias superiores a 100 GHz. En concreto, la antena de doble reflector para escaneo de haz es la primera antena reconfigurable electrónicamente a frecuencias superiores a 60 GHz que superan los 25 dBi de ganancia, siendo a su vez la primera antena de doble reflector que contiene un reflectarray reconfigurable como sub-reflector. Finalmente, se proponen ciertas mejoras que aún deben se deben realizar para hacer que estas antenas puedan ser un producto completamente desarrollado y competitivo en el mercado. ABSTRACT The work presented in this thesis is focused on the development of electronically reconfigurable antennas that are able to provide competitive electrical performance to the increasingly common applications operating at frequencies above 60 GHz. Specifically, this thesis presents the study, design, and implementation of reflectarray antennas, which incorporate liquid crystal (LC) materials to scan or reconfigure the beam electronically. From a general point of view, a liquid crystal can be defined as a material whose dielectric permittivity is variable and can be controlled with an external excitation, which usually corresponds with a quasi-static electric field (AC). By changing the dielectric permittivity at each cell that makes up the reflectarray, the phase shift on the aperture is controlled, so that a prescribed radiation pattern can be configured. Liquid Crystal-based reflectarrays have been chosen for several reasons. The first has to do with the advantages provided by the reflectarray antenna with respect to other high gain antennas, such as reflectors or phased arrays. The RF feeding in reflectarrays is achieved by using a common primary source (as in reflectors). This arrangement and the large number of degrees of freedom provided by the cells that make up the reflectarray (as in arrays), allow these antennas to provide a similar or even better electrical performance than other low profile antennas (reflectors and arrays), but assuming a more reduced cost and compactness. The second reason is the flexibility of the liquid crystal to be confined in an arbitrary geometry due to its fluidity (property of liquids). Therefore, the liquid crystal is able to adapt to a planar geometry so that it is one or more of the typical layers of this configuration. This simplifies drastically both the structure and manufacture of this type of antenna, even when compared with reconfigurable reflectarrays based on other technologies, such as diodes MEMS, etc. Therefore, the cost of developing this type of antenna is very small, which means that electrically large reconfigurable reflectarrays could be manufactured assuming low cost and greater productions. A paradigmatic example of a similar structure is the liquid crystal panel, which has already been commercialized successfully. The third reason lies in the fact that, at present, the liquid crystal is one of the few technologies capable of providing switching capabilities at frequencies above 60 GHz. In fact, the liquid crystal allows its permittivity to be switched in a wide range of frequencies, which are from DC to the visible spectrum, including microwaves and THz. Other technologies, such as ferroelectric materials, graphene or CMOS "on chip" technology also allow the beam to be switched at these frequencies. However, CMOS technology is expensive and is currently limited to frequencies below 150 GHz, and although ferroelectric materials or graphene can switch at higher frequencies and in a wider range, they have serious difficulties that make them immature. Ferroelectric materials involve the use of very high voltages to switch the material, making them unattractive, whereas the electromagnetic modelling of the graphene is still under discussion, so that the experimental results of devices based on this latter technology have not been reported yet. These three reasons make LC-based reflectarrays attractive for many applications that involve the use of electronically reconfigurable beams at frequencies beyond 60 GHz. Applications such as high resolution imaging radars, molecular spectroscopy, radiometers for atmospheric observation, or high frequency wireless communications (WiGig) are just some of them. This thesis is divided into three parts. In the first part, the most common properties of the liquid crystal materials are described, especially those exhibited in the nematic phase. The study is focused on the dielectric anisotropy (Ac) of uniaxial liquid crystals, which is defined as the difference between the parallel (e/7) and perpendicular (e±) permittivities: Ae = e,, - e±. This parameter allows the permittivity of a LC confined in an arbitrary volume at a certain biasing voltage to be described by solving a variational problem that involves both the electrostatic and elastic energies. Thus, the frequency dependence of (Ae) is also described and characterised. Note that an appropriate LC modelling is quite important to ensure enough accuracy in the phase shift provided by each cell that makes up the reflectarray, and therefore to achieve a good electrical performance at the antenna level. The second part of the thesis is focused on the design of resonant reflectarray cells based on liquid crystal. The reason why resonant cells have been chosen lies in the fact that they are able to provide enough phase range using the values of the dielectric anisotropy of the liquid crystals, which are typically small. Thus, the aim of this part is to investigate several reflectarray cell architectures capable of providing good electrical performance at the antenna level, which significantly improve the electrical performance of the cells reported in the literature. Similarly, another of the objectives is to develop a general tool to design these cells. To fulfill these objectives, the electrical yields of different types of resonant reflectarray elements are investigated, beginning from the simplest, which is made up of a single resonator and limits the state of the art. To overcome the electrical limitations of the single resonant cell, several elements consisting of multiple resonators are considered, which can be single-layer or multilayer. In a first step, the design procedure of these structures makes use of a conventional electromagnetic model which has been used in the literature, which considers that the liquid crystal behaves as homogeneous and isotropic materials whose permittivity varies between (e/7) y (e±). However, in this part of the thesis it is shown that the conventional modelling is not enough to describe the physical behaviour of the liquid crystal in reflectarray cells accurately. Therefore, a more accurate analysis and design procedure based on a more general model is proposed and developed, which defines the liquid crystal as an anisotropic three-dimensional inhomogeneous material. The design procedure is able to optimize multi-resonant cells efficiently to achieve good electrical performance in terms of bandwidth, phase range, losses, or sensitivity to the angle of incidence. The errors made when the conventional modelling (amplitude and phase) is considered have been also analysed for various cell geometries, by using measured results from several antenna prototypes made up of real liquid crystals at frequencies above 100 GHz. The measurements have been performed in a periodic environment using a quasi-optical bench, which has been designed especially for this purpose. One of these prototypes has been optimized to achieve a relatively large bandwidth (10%) at 100 GHz, low losses, a phase range of more than 360º, a low sensitivity to angle of incidence, and a low influence of the transversal inhomogeneity of the liquid crystal in the cell. The electrical yields of this prototype at the cell level improve those achieved by other elements reported in the literature, so that this prototype has been used in the last part of the thesis to perform several complete antennas for beam scanning applications. Finally, in this second part of the thesis, a novel strategy to characterise the macroscopic anisotropy using reflectarray cells is presented. The results in both RF and AC frequencies are compared with those obtained by other methods. The third part of the thesis consists on the study, design, manufacture and testing of LCbased reflectarray antennas in complex configurations. Note that the design procedure of a passive reflectarray antenna just consists on finding out the dimensions of the metallisations of each cell (which are used for phase control), using well-known optimization processes. However, in the case of reconfigurable reflectarrays based on liquid crystals, an additional step must be taken into account, which consists of accurately calculating the control voltages to be applied to each cell to configure the required phase-shift distribution on the surface of the antenna. Similarly, the structure to address the voltages at each cell and the control circuitry must be also considered. Therefore, the voltage synthesis is even more important than the design of the cell geometries (dimensions), since the voltages are directly related to the phase-shift. Several voltage synthesis procedures have been proposed in the state of the art, which are based on the experimental characterization of the phase/voltage curve. However, this characterization can be only carried out at a single angle of incidence and at certain cell dimensions, so that the synthesized voltages are different from those needed, thus giving rise to phase errors of more than 70°. Thus, the electrical yields of the LCreflectarrays reported in the literature are limited in terms of bandwidth, scanning range or side lobes level. In this last part of the thesis, a new voltage synthesis procedure has been defined and developed, which allows the required voltage to be calculated at each cell using simulations that take into account the particular dimensions of the cells, their angles of incidence, the frequency, and the AC biasing signal (frequency and waveform). The strategy is based on the modelling of each one of the permittivity states of the liquid crystal as an anisotropic substrate with longitudinal inhomogeneity (1D), or in certain cases, as an equivalent homogeneous tensor. The accuracy of both electromagnetic models is also discussed. The phase errors made by using the proposed voltage synthesis are better than 7º. In order to obtain an efficient tool to analyse and design the reflectarray, an electromagnetic analysis tool based on the Method of Moments in the spectral domain (SD-MoM) has also written and developed for anisotropic stratified media, which is used at each iteration of the voltage synthesis procedure. The voltage synthesis is also designed to minimize the effect of amplitude ripple on the radiation pattern, which is typical of reflectarrays made up of cells exhibiting high losses and represents a further advance in achieving a better antenna performance. To calculate the radiation patterns used in the synthesis procedure, an element-by-element analysis is assumed, which considers the local periodicity approach. Under this consideration, the use of a novel method is proposed, which avoids the limitation that the local periodicity imposes on the excitation. Once the appropriate strategy to calculate the voltages to be applied at each cell is developed, and once it is designed and manufactured both the structure to address the voltages to the antenna and the control circuits, two complete LC-based reflectarray antennas that operate at 100 GHz have been designed, manufactured and tested using the previously presented cells. The first prototype consists of a single offset reflectarray with beam scanning capabilities on one plane (elevation and azimuth). Although several LC-reflectarray antennas that provide 2-D scanning capabilities are also designed, and certain strategies to achieve the 2-D addressing of the voltage are proposed, the manufactured prototype addresses the voltages in one dimension in order to reduce the number of controls and manufacturing errors, and thereby validating the design tool. For an average aperture size (with a number of rows and columns of between 30 and 50 elements, which means a reflectarray with more than 900 cells), the single offset configuration provides an antenna gain of between 20 and 30 dBi and a large scanning range. The prototype tested at 100 GHz exhibits an electronically scanned beam in an angular range of 55º and 8% of bandwidth, in which the side lobe level (SLL) remains better than -13 dB. The maximum gain is 19.4 dBi. The electrical performance of the antenna is clearly an improvement on those achieved by other authors in the state of the art. The second prototype corresponds to a dual reflector antenna with a liquid crystal-based reflectarray used as a sub-reflector for beam scanning in one plane (azimuth or elevation). The main objective is to obtain a higher gain than that provided by the single offset configuration, but using a more compact architecture. In this case, a maximum gain of 35 dBi is achieved, although at the expense of reducing the scanning range to 12°, which is inherent in this type of structure. As a general statement, the voltage synthesis and the design procedure of the cells, jointly make up a complete, accurate and efficient design tool of reconfigurable reflectarray antennas based on liquid crystals. The tool has been validated by testing the previously mentioned prototypes at 100 GHz, which achieve something never reached before for this type of antenna: a competitive electrical performance, and an excellent prediction of the results. The design procedure is general and therefore can be used at any frequency for which the liquid crystal exhibits dielectric anisotropy. The two prototypes designed, manufactured and tested in this thesis are also some of the first antennas that currently operate at frequencies above 100 GHz. In fact, the dual reflector antenna is the first electronically scanned dual reflector antenna at frequencies above 60 GHz (the operation frequency is 100 GHz) with a gain greater than 25 dBi, being in turn the first dual-reflector antenna with a real reconfigurable sub-reflectarray. Finally, some improvements that should be still investigated to make these antennas commercially competitive are proposed.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Structure–function studies of rhodopsin kinase (RK; EC 2.7.1.125) require a variety of mutants. Therefore, there is need for a suitable system for the expression of RK mutant genes. Here we report on a study of expression of the RK gene in baculovirus-infected Sf21 cells and characterization of the enzyme produced as purified to near homogeneity. Particular attention has been paid to the post-translational modifications, autophosphorylation and isoprenylation, found in the native bovine RK. The protein produced has been purified using, successively, heparin-Sepharose, Mono Q, and Mono S FPLC (fast protein liquid chromatography) and was obtained in amounts of about 2 mg from 1 liter of cell culture. The enzyme from the last step of purification was obtained in two main fractions that differ in the level of phosphorylation. The protein peak eluted first carries two phosphate groups per protein, whereas the second protein peak is monophosphorylated. Further, while both peaks are isoprenylated, the isoprenyl groups consist of mixtures of C5, C10, C15, and C20 isoprenyl moieties. From these results, we conclude that the above expression system is suitable for some but not all aspects of structure–function studies.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Multiple growth factors synergistically stimulate proliferation of primitive hematopoietic progenitor cells. A human myeloid cell line, KPB-M15, constitutively produces a novel hematopoietic cytokine, termed stem cell growth factor (SCGF), possessing species-specific proliferative activities. Here we report the molecular cloning, expression, and characterization of a cDNA encoding human SCGF using a newly developed λSHDM vector that is more efficient for differential and expression cloning. cDNA for SCGF encodes a 29-kDa polypeptide without N-linked glycosylation. SCGF transiently produced by COS-1 cells supports growth of hematopoietic progenitor cells through a short-term liquid culture of bone marrow cells and exhibits promoting activities on erythroid and granulocyte/macrophage progenitor cells in primary semisolid culture with erythropoietin and granulocyte/macrophage colony-stimulating factor, respectively. Expression of SCGF mRNA is restricted to myeloid cells and fibroblasts, suggesting that SCGF is a growth factor functioning within the hematopoietic microenvironment. SCGF could disclose some human-specific mechanisms as yet unidentified from studies on the murine hematopoietic system.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

In maize (Zea mays L.) two leaf-specific ferredoxin (Fd) isoproteins, Fd I and Fd II, are distributed differentially in mesophyll and bundle-sheath cells. A novel cDNA encoding the precursor of Fd II (pFD2) was isolated by heterologous hybridization using a cDNA for Fd I (pFD1) as a probe. The assignment of the cDNAs to the Fds was verified by capillary liquid-chromatography/electrospray ionization-mass spectrometry. RNA-blot analysis demonstrated that transcripts for Fd I and Fd II accumulated specifically in mesophyll and bundle-sheath cells, respectively. The mature regions of pFD1 and pFD2 were expressed in Escherichia coli as functional Fds. Fd I and Fd II had similar redox potentials of −423 and −406 mV, respectively, but the Km value of Fd-NADP+ reductase for Fd II was about 3-fold larger than that for Fd I. Asparagine at position 65 of Fd II is a unique residue compared with Fd I and other Fds from various plants, which have aspartic acid or glutamic acid at the corresponding position as an electrostatic interaction site with Fd-NADP+ reductase. Substitution of asparagine-65 with aspartic acid increased the affinity of Fd II with Fd-NADP+ reductase to a level comparable to that of Fd I. These structural and functional differences of Fd I and Fd II may be related to their cell-specific expression in the leaves of a C4 plant.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

We investigated the molecular and physiological processes of sugar uptake and metabolism during pollen tube growth and plant fertilization. In vitro germination assays showed that petunia (Petunia hybrida) pollen can germinate and grow not only in medium containing sucrose (Suc) as a carbon source, but also in medium containing the monosaccharides glucose (Glc) or fructose (Fru). Furthermore, high-performance liquid chromatography analysis demonstrated a rapid and complete conversion of Suc into equimolar amounts of Glc and Fru when pollen was cultured in a medium containing 2% Suc. This indicates the presence of wall-bound invertase activity and uptake of sugars in the form of monosaccharides by the growing pollen tube. A cDNA designated pmt1 (petunia monosaccharide transporter 1), which is highly homologous to plant monosaccharide transporters, was isolated from petunia. Pmt1 belongs to a small gene family and is expressed specifically in the male gametophyte, but not in any other vegetative or floral tissues. Pmt1 is activated after the first pollen mitosis, and high levels of mRNA accumulate in mature and germinating pollen. A model describing the transport of sugars to the style, the conversion of Suc into Glc and Fru, and the active uptake by a monosaccharide transporter into the pollen tube is presented.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

In this study we characterized phosphoribulokinase (PRK, EC 2.7.1.19) from the eukaryotic marine chromophyte Heterosigma carterae. Serial column chromatography resulted in approximately 300-fold purification of the enzyme. A polypeptide of 53 kD was identified as PRK by sequencing the amino terminus of the protein. This protein represents one of the largest composite monomers identified to date for any PRK. The native holoenzyme demonstrated by flow performance liquid chromatography a molecular mass of 214 ± 12.6 kD, suggesting a tetrameric structure for this catalyst. Because H. carterae PRK activity was insensitive to NADH but was stimulated by dithiothreitol, it appears that the enzyme may require a thioredoxin/ferredoxin rather than a metabolite mode of regulation. Kinetic analysis of this enzyme demonstrated Michaelis constant values of ribulose-5-phosphate (226 μm) and ATP (208 μm), respectively. In summary, H. carterae PRK is unique with respect to holoenzyme structure and function, and thus may represent an alternative evolutionary pathway in Calvin-cycle kinase development.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

We studied transcription initiation in the mitochondria of higher plants, with particular respect to promoter structures. Conserved elements of these promoters have been successfully identified by in vitro transcription systems in different species, whereas the involved protein components are still unknown. Proteins binding to double-stranded oligonucleotides representing different parts of the pea (Pisum sativum) mitochondrial atp9 were analyzed by denaturation-renaturation chromatography and mobility-shift experiments. Two DNA-protein complexes were detected, which appeared to be sequence specific in competition experiments. Purification by hydroxyapatite, phosphocellulose, and reversed-phase high-pressure liquid chromatography separated two polypeptides with apparent molecular masses of 32 and 44 kD. Both proteins bound to conserved structures of the pea atp9 and the heterologous Oenothera berteriana atp1 promoters and to sequences just upstream. Possible functions of these proteins in mitochondrial promoter recognition are discussed.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Cholecystokinin (CCK) secretion in rats and humans is inhibited by pancreatic proteases and bile acids in the intestine. It has been hypothesized that the inhibition of CCK release caused by pancreatic proteases is due to proteolytic inactivation of a CCK-releasing peptide present in intestinal secretion. To purify the putative luminal CCK-releasing factor (LCRF), intestinal secretions were collected by perfusing a modified Thiry-Vella fistula of jejunum in conscious rats. From these secretions, the peptide was concentrated by ultrafiltration followed by low-pressure reverse-phase chromatography and purified by reverse-phase high-pressure liquid chromatography. Purity was confirmed by high-performance capillary electrophoresis. Fractions were assayed for CCK-releasing activity by their ability to stimulate pancreatic protein secretion when infused into the proximal small intestine of conscious rats. Partially purified fractions strongly stimulated both pancreatic secretion and CCK release while CCK receptor blockade abolished the pancreatic response. Amino acid analysis and mass spectral analysis showed that the purified peptide is composed of 70-75 amino acid residues and has a mass of 8136 Da. Microsequence analysis of LCRF yielded an amino acid sequence for 41 residues as follows: STFWAYQPDGDNDPTDYQKYEHTSSPSQLLAPGDYPCVIEV. When infused intraduodenally, the purified peptide stimulated pancreatic protein and fluid secretion in a dose-related manner in conscious rats and significantly elevated plasma CCK levels. Immunoaffinity chromatography using antisera raised to synthetic LCRF-(1-6) abolished the CCK releasing activity of intestinal secretions. These studies demonstrate, to our knowledge, the first chemical characterization of a luminally secreted enteric peptide functioning as an intraluminal regulator of intestinal hormone release.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Carbon molecular sieve membranes have been analyzed in supported and unsupported configurations in this experimental study. The membranes were used to adsorb CO2, N2 and CH4, and their adsorption data were analyzed to establish differences in rate and capacity of adsorption between the two types of samples (supported and unsupported). Experimental results show an important effect of the support, which can be considered as an additional parameter to tailor pore size on these carbon membranes. Immersion calorimetry values were measured by immersing the membranes into liquids of different molecular dimensions (dichloromethane, benzene, n-hexane, 2,2-dimethylbutane). Similarities were found between adsorption and calorimetric analysis. The pore volume of the samples analyzed ranged from 0.016 to 0.263 cm3/g. The effect of the pyrolysis temperature, either 550 or 700 °C, under N2 atmosphere was also analyzed. Quantification of the pore-size distribution of the support was done by liquid-liquid displacement porosimetry. The composite membrane was used for CO2/CH4 separation before and after pore plugging was done. The ideal selectivity factors value (4.47) was over the Knudsen theoretical factor (0.60) for membrane pyrolyzed at 600 °C, which indicates the potential application of these membranes for the separation of low-molecular weight gases.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

ISCOMs have received much attention as vaccine adjuvants due to their immunostimulatory effects. They are colloidal particles typically comprised of phospholipids, cholesterol and Quil A, a crude mixture of saponins extracted from the bark of Quillaja saponaria Molina. We have previously shown that ISCOMs can be prepared by ether injection wherein an ether solution of phospholipids and cholesterol in a mass ratio of 5:2 is injected into a solution of Quil A at a mass ratio of 7 lipids: 3 Quil A. The aim of this study was firstly to isolate and characterise discrete fractions of Quil A and secondly to investigate which of these fractions were able to form ISCOMs by the method of ether injection. Six fractions of Quil A were isolated by semi-preparative reverse phase high performance liquid chromatography (RP-HPLC) and characterised by analytical HPLC, liquid chromatography tandem mass spectrometry (LC-MS) and the qualitative Liebermann- Burchard and Molisch tests for triterpenoids and carbohydrates respectively. ISCOMs were subsequently prepared from the isolated fractions by the method of ether injection and the resulting preparations characterized by photon correlation spectroscopy (PCS) and negative stain transmission electron microscopy (TEM). The molecular weights of the major compounds in the fractions ranged from ∼1200 to ∼2300 Da; all fractions tested positive for triterpenoids and saccharides and four of the fractions were identified as QS-7, QS-17, QS-18 and QS-21 by analysis (LC-MS and analytical HPLC). Injection of ether solutions of lipids into aqueous solutions of QS-17, QS-18 or QS-21 all resulted in homogeneous ISCOM dispersions. The combination of lipids and QS-7 by ether injection produced lamellae and liposomes as the prominent structures and a minor amount of ISCOMs. The remaining two hydrophilic, low molecular weight fractions of Quil A did not produce ISCOMs, instead liposomes and helical structures predominated in the samples.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

Studies were performed to investigate the UDP-glucuronosyltransferase enzyme( s) responsible for the human liver microsomal N2-glucuronidation of the anticonvulsant drug lamotrigine ( LTG) and the mechanistic basis for the LTG-valproic acid ( VPA) interaction in vivo. LTG N2-glucuronidation by microsomes from five livers exhibited atypical kinetics, best described by a model comprising the expressions for the Hill ( 1869 +/- 1286 mu M, n = 0.65 +/- 0.16) and Michaelis-Menten ( Km 2234 +/- 774 mu M) equations. The UGT1A4 inhibitor hecogenin abolished the Michaelis-Menten component, without affecting the Hill component. LTG N2-glucuronidation by recombinant UGT1A4 exhibited Michaelis-Menten kinetics, with a K-m of 1558 mu M. Although recombinant UGT2B7 exhibited only low activity toward LTG, inhibition by zidovudine and fluconazole and activation by bovine serum albumin ( BSA) ( 2%) strongly suggested that this enzyme was responsible for the Hill component of microsomal LTG N2-glucuronidation. VPA ( 10 mM) abolished the Hill component of microsomal LTG N2-glucuronidation, without affecting the Michaelis-Menten component or UGT1A4-catalyzed LTG metabolism. K-i values for inhibition of the Hill component of LTG N2-glucuronidation by VPA were 2465 +/- 370 mu M and 387 +/- 12 mu M in the absence and presence, respectively, of BSA ( 2%). Consistent with published data for the effect of fluconazole on zidovudine glucuronidation by human liver microsomal UGT2B7, the Ki value generated in the presence of BSA predicted the magnitude of the LTG-VPA interaction reported in vivo. These data indicate that UGT2B7 and UGT1A4 are responsible for the Hill and Michaelis-Menten components, respectively, of microsomal LTG N2-glucuronidation, and the LTG-VPA interaction in vivo arises from inhibition of UGT2B7.