Physical oceanography from CTD during Maria S. Merian cruise MSM20/4 in spring 2012

With an extension of > 40 km**2 the recently discovered Campeche cold-water coral province located at the northeastern rim of the Campeche Bank in the southern Gulf of Mexico belongs to the largest coherent cold-water coral areas discovered so far. The Campeche province consists of numerous 20-40 m-high elongated coral mounds that are developed in intermediate water depths of 500 to 600 m. The mounds are colonized by a vivid cold-water coral ecosystem that covers the upper flanks and summits. The rich coral community is dominated by the framework-building Scleractinia Enallopsammia profunda and Lophelia pertusa, while the associated benthic megafauna shows a rather scarce occurrence. The recent environmental setting is characterized by a high surface water production caused by a local upwelling center and a dynamic bottom-water regime comprising vigorous bottom currents, obvious temporal variability, and strong density contrasts, which all together provide optimal conditions for the growth of cold-water corals. This setting - potentially supported by the diel vertical migration of zooplankton in the Campeche area - controls the delivering of food particles to the corals. The Campeche cold-water coral province is, thus, an excellent example highlighting the importance of the oceanographic setting in securing the food supply for the development of large and vivid cold-water coral ecosystems.

Synthesis and structure elucidation of kappa-casein (45-87) - A two dimensional nuclear magnetic resonance study

We have shown that 44 amino acid residues N-terminal segment of kappa-casein exhibits considerable a-helical structure. This prompted us to investigate the structures of the remaining segments of kappa-casein. Thus, in this study the chemical synthesis and structure elucidation of the peptide 45-87 amino acid residues of kappa-casein is reported. The peptide was assembled using solid phase peptide synthesis methodology on pam resin, cleaved via HF, freeze dried and, after purification, characterised by mass spectrometry (observed m/z 4929; calculated mit 4929.83). The amino acid sequence of the peptide is: CKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKA Its structure elucidation has been carried out using circular dichroism (CD) and nuclear magnetic resonance (NMR) techniques. CD spectrum of the peptide shows it to be a random structure in water but in 30% trifluoroethanol the peptide exhibits considerable structure. The 1D and 2D NMR spectra corroborated the results of CD. The structure elucidation of the peptide using TOCSY and NOESY NMR techniques will be discussed.

Proposta de um modelo de relatório de administração para o setor público baseado no Parecer de Orientação nº 15/87 da Comissão de Valores Mobiliários: um instrumento de governança corporativa para a administração pública

Este artigo analisa os gastos públicos dos 10 maiores municípios dos estados da região Sul do Brasil, revelando a ausência de transparência nos demonstrativos publicados pelas administrações públicas. Assim, propõe um relatório de administração para o setor público baseado no Parecer de Orientação nº15/87 da Comissão de Valores Mobiliários (CVM), como forma de aumentar a transparência das demonstrações contábeis publicadas pela administração pública, atendendo aos princípios de boas práticas de governança.

Hydrachnidae und Halacaridae, bearbeitet von dr. R. Piersig ... und dr. H. Lohmann ... Mit 87 abbildungen.

13

Analysis of functional impairments of the human P2Y 11 nucleotide receptor with the alanine-87 - threonine mutation, and development of novel agonists specific for the human P2Y 11 and P2Y 6 receptors

Magdeburg, Univ., Fak. für Naturwiss., Diss., 2015

Guidance on Analysis (PDF 87 KB)

HPSS Guidance on Analysist of Risk/Risk Rating Matrix

Dietetic Managers (PDF 87 KB)

NI Strategy Document 2002 - 2005