Isolation and identification of a diuretic hormone from the mealworm Tenebrio molitor.

A diuretic hormone of unusual structure was isolated from extracts of whole heads of the mealworm Tenebrio molitor. The hormone is a 37-aa peptide of 4371 Da, with the sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN. This peptide increases cAMP production in Malpighian tubules of T. molitor. The amino acid sequence reveals that this peptide is a member of the family of sauvagine/corticotropin-releasing factor/urotensin I-related insect diuretic hormones. The C-terminal sequence of this peptide is quite different from other members of this family, which have a hydrophobic C terminus (isoleucinamide or valinamide). When aligned comparably, T. molitor diuretic hormone has a more hydrophilic C terminus, leucylasparagine (free acid). In contrast to all other known diuretic hormones of this family, this peptide has exceptionally low stimulatory activity on cAMP production in Malpighian tubules of Manduca sexta. However, at nanomolar concentrations it stimulates cAMP production in Malpighian tubules of T. molitor. Diuretic hormones of this family have been isolated previously from Lepidoptera, Orthoptera, Dictyoptera, and Diptera. This appears to be the first diuretic hormone isolated from a coleopteran insect.

The Cambridge natural history,

Vols. 1, 2, 5-7, 9 reprinted 1922; v. 3, 1927; and vols. 4, 8, 10, 1923.

Index to experiment station literature, 1888-1913 ...

Volume numbers assigned for convenience in cataloging.

Puteshestvi e v Turkestan /

Includes bibliographical references and indexes.

Die Orthopteren der Schweiz und der Nachbarländer auf geographischer sowie oekologischer Grundlage mit Berücksichtigung der fossilen Arten.

Reprinted from Archiv für Naturgeschichte. 87. Jahrg, Abt. A, 5. Heft, 1921.

Notes Orthoptérologiques.

Paging also numbered [89]-160.

Catalogue des orthoptères de l'Amérique méridionale ...

Mode of access: Internet.

Orthoptères et dermaptères,

"Index bibliographique" : p. [190]-201.

The male genitalia of orthopteroid insects.

Mode of access: Internet.

The life of the grasshopper,

Some of the chapters have already appeared, part under different titles and part in an abbreviated form, in an interesting miscellany extracted from the Souvenirs, translated by Mr. Bernard Miall, under the title of Social life in the insect world. cf. Translator's note.

Recensio orthopterorum. Revue critique des orthoptères,

Mode of access: Internet.

Zur Systematik der orthopteroiden Insekten.

"Extrait de Treubia", v. 1, livr. 4.

Guide to the insects of Connecticut,

Parts I-II contained in Bulletin 16.

Mémoire sur les métamorphoses des Perles /

Caption title.