Age determination of sediment cores off western Spitsbergen

The Late Weichselian glacial history of the continental shelf off western Spitsbergen is discussed, based on acoustic sub-bottom records and sediment cores. The outer part of Isfjorden and the inner shelf to the west of this fjord are characterized by a thin veneer (10-20 m) of glacigenic sediments and absence of ice-marginal features. Towards the outer shelf the sediment thickness increases significantly, and exceeds 500 m at the shelf edge. Possible moraine complexes were identified in this outer part. Sediment cores from the inner shelf sampled a firm diamicton, interpreted as till, beneath soft glaciomarine sediments. Radiocarbon dates on shells from the clay resting directly on the till, suggest an age of around 12,500 yrs B.P. for the base of the marine sequence. We argue that grounded ice covered the sites shortly before. In contrast to suggestions that the fjords and coast were partly ice free during the Late Weischselian, we conclude that the ice must have reached out onto the continental shelf.

Synthesis and structure elucidation of kappa-casein (45-87) - A two dimensional nuclear magnetic resonance study

We have shown that 44 amino acid residues N-terminal segment of kappa-casein exhibits considerable a-helical structure. This prompted us to investigate the structures of the remaining segments of kappa-casein. Thus, in this study the chemical synthesis and structure elucidation of the peptide 45-87 amino acid residues of kappa-casein is reported. The peptide was assembled using solid phase peptide synthesis methodology on pam resin, cleaved via HF, freeze dried and, after purification, characterised by mass spectrometry (observed m/z 4929; calculated mit 4929.83). The amino acid sequence of the peptide is: CKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKA Its structure elucidation has been carried out using circular dichroism (CD) and nuclear magnetic resonance (NMR) techniques. CD spectrum of the peptide shows it to be a random structure in water but in 30% trifluoroethanol the peptide exhibits considerable structure. The 1D and 2D NMR spectra corroborated the results of CD. The structure elucidation of the peptide using TOCSY and NOESY NMR techniques will be discussed.

Proposta de um modelo de relatório de administração para o setor público baseado no Parecer de Orientação nº 15/87 da Comissão de Valores Mobiliários: um instrumento de governança corporativa para a administração pública

Este artigo analisa os gastos públicos dos 10 maiores municípios dos estados da região Sul do Brasil, revelando a ausência de transparência nos demonstrativos publicados pelas administrações públicas. Assim, propõe um relatório de administração para o setor público baseado no Parecer de Orientação nº15/87 da Comissão de Valores Mobiliários (CVM), como forma de aumentar a transparência das demonstrações contábeis publicadas pela administração pública, atendendo aos princípios de boas práticas de governança.

Hydrachnidae und Halacaridae, bearbeitet von dr. R. Piersig ... und dr. H. Lohmann ... Mit 87 abbildungen.

13

Analysis of functional impairments of the human P2Y 11 nucleotide receptor with the alanine-87 - threonine mutation, and development of novel agonists specific for the human P2Y 11 and P2Y 6 receptors

Magdeburg, Univ., Fak. für Naturwiss., Diss., 2015

Guidance on Analysis (PDF 87 KB)

HPSS Guidance on Analysist of Risk/Risk Rating Matrix

Dietetic Managers (PDF 87 KB)

NI Strategy Document 2002 - 2005

Cambios en densidad, número y biomasa de la población de de la Concha de Abanico (Argopecten purpuratus) en la Bahía Independencia (Pisco, Perú) durante 1984-87

Se presentan los cambios de densidad y biomasa de la población de de la Concha de Abanico (Argopecten purpuratus) en Bahía Independencia. Los análisis indican que tanto la temperatura como el oxigeno han influenciado en los cambios de los niveles poblacionales.