39 resultados para beta function

em Reposit


Relevância:

100.00% 100.00%

Publicador:

Resumo:

A decomposition of identity is given as a complex integral over the coherent states associated with a class of shape-invariant self-similar potentials. There is a remarkable connection between these coherent states and Ramanujan's integral extension of the beta function.

Relevância:

70.00% 70.00%

Publicador:

Resumo:

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Relevância:

60.00% 60.00%

Publicador:

Resumo:

O presente trabalho teve como objetivo avaliar sob condições de laboratório, o efeito de temperatura (15, 18, 20, 21, 24, 25, 27, 30, 33 e 35 ± 1 ºC) nas condições escuro, luz contínua e fotoperíodo 12/12 h, na produção de pseudotécios de isolados de Guignardia citricarpa, provenientes de regiões cítricolas dos Estados de São Paulo e Rio de Janeiro. Discos de folhas de limoeiro 'Cravo' (Citrus limonia), de 12 mm de diâmetro, foram autoclavados e depositadas (parte abaxial) na superfície do meio de cultura constituído por ágar-água 2%. Foram colocados quatro discos de folhas por placa onde, de forma conjunta e intercalar aos mesmos, depositaram-se dois discos obtidos de colônias de Phyllosticta citricarpa, com 21 dias de incubação. Foi, também, estudado o efeito da temperatura e do tempo de incubação (2, 8 e 16 h) na germinação dos ascósporos. Após 21 dias de incubação, a ótima temperatura ajustada pela função beta generalizada, para produção de pseudotécios deu-se a 26 e 22,5 a 27,5 °C, sob condição de escuro e de luz, respectivamente. Observou-se também produção de pseudotécios a 27 ºC em fotoperíodo 12/12 h. em estudo complementar foi verificado que, aos 19 dias, a 27 ºC, cerca de 90% dos pseudotécios haviam alcançado a maturidade, com abundante produção de ascósporos. A maior porcentagem de ascósporos germinados foi constatada na temperatura de 24 ºC, após 16 h de incubação. Dentre as vantagens alcançadas, incluem-se a possibilidade (i) da produção massal de ascósporos em curto período de tempo, e (ii) da padronização do inóculo, tanto qualitativa, quanto quantitativa.

Relevância:

60.00% 60.00%

Publicador:

Resumo:

In the classical pure spinor worldsheet theory of AdS(5) x S-5 there are some vertex operators which do not correspond to any physical excitations. We study their flat space limit. We find that the BRST operator of the worldsheet theory in flat space-time can be nontrivially deformed without deforming the worldsheet action. Some of these deformations describe the linear dilaton background. But the deformation corresponding to the nonphysical vertex differs from the linear dilaton in not being worldsheet parity even. The nonphysically deformed worldsheet theory has nonzero beta-function at one loop. This means that the classical Type IIB SUGRA backgrounds are not completely characterized by requiring the BRST symmetry of the classical worldsheet theory; it is also necessary to require the vanishing of the one-loop beta-function.

Relevância:

60.00% 60.00%

Publicador:

Resumo:

Using the Langevin approach for stochastic processes, we study the renormalizability of the massive Thirring model. At finite fictitious time, we prove the absence of induced quadrilinear counterterms by verifying the cancellation of the divergencies of graphs with four external lines. This implies that the vanishing of the renormalization group beta function already occurs at finite times.

Relevância:

60.00% 60.00%

Publicador:

Resumo:

Asiatic citrus canker, caused by Xanthomonas smithii ssp. citri, formerly X. axonopodis pv. citri, is one of the most serious phytosanitary problems in Brazilian citrus crops. Experiments were conducted under controlled conditions to assess the influence of temperature and leaf wetness duration on infection and subsequent symptom development of citrus canker in sweet orange cvs Hamlin, Natal, Pera and Valencia. The quantified variables were incubation period, disease incidence, disease severity, mean lesion density and mean lesion size at temperatures of 12, 15, 20, 25, 30, 35, 40 and 42 degrees C, and leaf wetness durations of 0, 4, 8, 12, 16, 20 and 24 h. Symptoms did not develop at 42 degrees C. A generalized beta function showed a good fit to the temperature data, severity being highest in the range 30-35 degrees C. The relationship between citrus canker severity and leaf wetness duration was explained by a monomolecular model, with the greatest severity occurring at 24 h of leaf wetness, with 4 h of wetness being the minimum duration sufficient to cause 100% incidence at optimal temperatures of 25-35 degrees C. Mean lesion density behaved similarly to disease severity in relation to temperature variation and leaf wetness duration. A combined monomolecular-beta generalized model fitted disease severity, mean lesion density or lesion size as a function of both temperature and duration of leaf wetness. The estimated minimum and maximum temperatures for the occurrence of disease were 12 degrees C and 40 degrees C, respectively.

Relevância:

60.00% 60.00%

Publicador:

Resumo:

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Relevância:

60.00% 60.00%

Publicador:

Resumo:

Pós-graduação em Física - IFT

Relevância:

60.00% 60.00%

Publicador:

Resumo:

Pós-graduação em Física - IFT

Relevância:

40.00% 40.00%

Publicador:

Resumo:

In a cross-sectional study, we assessed beta-cell function and insulin sensitivity index (ISI) with hyperglycemic clamps (10 mmol/l) in 24 subjects with impaired fasting glycemia (IFG, fasting plasma glucose [FPG] between 6.1 and 7.0 mmol/l), 15 type 2 diabetic subjects (FPG >7.0 mmol/l), and 280 subjects with normal fasting glycemia (NFG, FPG <6.1 mmol/l). First-phase insulin release (0-10 min) was lower in IFG (geometric mean 541 pmol/l (.) 10 min; 95% confidence interval [CI] 416-702 pmol/l (.) 10 min) and in type 2 diabetes (geometric mean 376 pmol/l (.) 10 min; 95% CI 247-572 pmol/l (.) 10 min) than NFG (geometric mean 814 pmol/l (.) 10 min; 95% CI 759-873 pmol/l (.) 10 min) (P < 0.001). Second-phase insulin secretion (140-180 min) was also lower in IFG (geometric mean 251 pmol/l; 95% CI 198-318 pmol/l; P = 0.026) and type 2 diabetes (geometric mean 157 pmol/l; 95% CI 105-235 pmol/l; P < 0.001) than NFG (geometric mean 295 pmol/l; 95% CI 276-315 pmol/l): IFG and type 2 diabetic subjects had a lower ISI (0.15 +/- 0.02 and 0.16 +/- 0.02 mumol/kg fat-free mass [FFM]/min/ pmol/l, respectively) than NFG (0.24 +/- 0.01 mumol/kg FFM/min/pmol/l, P < 0.05). We found a stepwise decline in first-phase (and second-phase) secretion in NFG subjects with progressive decline in oral glucose tolerance (P < 0.05). IFG subjects with impaired glucose tolerance (IGT) had lower first-phase secretion than NFG subjects with IGT (P < 0.02), with comparable second-phase secretion and ISI. NFG and IFG subjects with a diabetic glucose tolerance (2-h glucose >11.1 mmol/l) had a lower ISI than their respective IGT counterparts (P < 0.05). We conclude that the early stages of glucose intolerance are associated with disturbances in beta-cell function, while insulin resistance is seen more markedly in later stages.

Relevância:

40.00% 40.00%

Publicador:

Resumo:

We performed hyperglycemic clamps in 283 nondiabetic Caucasians and, with multiple linear regression, determined the contribution of beta-cell function and tissue insulin sensitivity to variations in glycemia and insulinemia during oral glucose tolerance tests (OGTTs). Impaired glucose tolerance (IGT) subjects had reduced insulin sensitivity(P < .02) and beta-cell function (P < .0001). Normal glucose tolerance (NGT) subjects with first-degree type 2 diabetic relatives had reduced first and second phase insulin secretion (both, P < .05), but normal insulin sensitivity(P = .37). beta-Cell function and insulin sensitivity accounted for one fourth of the variability in glucose tolerance. Fasting plasma glucose in subjects with NGT (n = 185) was a function of both phases of insulin secretion and of insulin sensitivity tall, P < .05), whereas, in IGT subjects (n = 98), it was a function of first phase insulin secretion and insulin sensitivity(P < .01). Two-hour glycemia was a function of second phase secretion and insulin sensitivity (P < .01). Fasting and 2-hour plasma insulin levels were determined by insulin sensitivity land glycemia) in NGT subjects (P < .001), but by second phase secretion in IGT (P < .001). We conclude that beta-cell function is reduced in subjects with IGT; glycemia and insulinemia are not regulated by the same mechanisms in IGT and NGT; insulin sensitivity does not contribute to insulinemia in IGT; family history of diabetes influences beta-cell function, but not insulin sensitivity in Caucasians. Copyright (C) 2000 by W.B. Saunders Company.

Relevância:

30.00% 30.00%

Publicador:

Resumo:

In this work we isolated a novel crotamine like protein from the Crotalus durissus cascavella venom by combination of molecular exclusion and analytical reverse phase HPLC. Its primary structure was:YKRCHKKGGHCFPKEKICLPPSSDLGKMDCRWKRK-CCKKGS GK. This protein showed a molecular mass of 4892.89 da that was determined by Matrix Assisted Laser Desorption Ionization Time-of-flight (MALDI-TOF) mass spectrometry. The approximately pI value of this protein was determined in 9.9 by two-dimensional electrophoresis. This crotamine-like protein isolated here and that named as Cro 2 produced skeletal muscle spasm and spastic paralysis in mice similarly to other crotamines like proteins. Cro 2 did not modify the insulin secretion at low glucose concentration (2.8 and 5.6 mM), but at high glucose concentration (16.7 mM) we observed an insulin secretion increasing of 2.7-3.0-fold than to control. The Na+ channel antagonist tetrodoxin (6 mM) decreased glucose and Cro 2-induced insulin secretion. These results suggested that Na+ channel are involved in the insulin secretion. In this article, we also purified some peptide fragment from the treatment of reduced and carboxymethylated Cro 2 (RC-Cro 2) with cyanogen bromide and protease V8 from Staphylococcus aureus. The isolated pancreatic beta-cells were then treated with peptides only at high glucose concentration (16.7 mM), in this condition only two peptides induced insulin secretion. The amino acid sequence homology analysis of the whole crotamine as well as the biologically-active peptide allowed determining the consensus region of the biologically-active crotamine responsible for insulin secretion was KGGHCFPKE and DCRWKWKCCKKGSG.