Classification of lumber of Eucalyptus using non-destructive tests

Classification and standardization of the sawn wood is a usual activity, developed by countries that come as great consumers of this material. Brazil does not practice the classification of sawn wood. This work had the main objective of evaluating the sensibility of most common non-destructive tests in the classification of dimension lumber from fast grown Eucalyptus plantation. Wood was obtained from genetic material cultivated at Minas Gerais State, Brazil. 296 beams of structural dimensions (6 cm × 12 cm × 280 cm) from 10 different clones of Eucalyptus were sampled. Beams were non-destructively (stress wave, ultrasound and transverse vibration) and destructively (static bending and compression parallel to grain) tested. Non-destructive results showed sensibility in the classification of structural dimension lumber, being possible to establish wave velocity intervals that attend to the main strength classes reported by Wooden Structures Brazilian Code.

Classificação de peças de madeira serrada de dimensões estruturais de Eucalyptus sp com uso de ensaios não-destrutivo

Pós-graduação em Agronomia (Energia na Agricultura) - FCA

O olhar de um discente sobre seu futuro docente: uma trajetória auto formativa

The writings of this paper refer to several personal experiences as well as the various conflicts in the initial educational formation, where I'm reflecting about the formation intentions of this course. I do an analysis and a reflection of the pedagogical practices developed during graduation in institutional spaces, as well as the understanding of the complex context and teaching actions intrinsic to this, that are what constitute the structural dimensions which is where the formative process happens. This study is a narrative of initial formation as autobiographical. Memories and experiences are analyzed along with undergraduate education, exposing structural problems of course requiring a deeper analysis. In addition to analyse critically the institutional spaces of the (few) outreach programs, education and research that are the basis of the Brazilian University, the wellknown University quadripod. Under this perspective, the narrative brings the dichotomous design of the quadripod inside the University course, exposing the need to reflect on this fact, as it culminates in the formation of future teachers in physics. Nevertheless, the work seeks to raise awareness for the need for enhancement of teaching career at the University to address the teaching crisis which today proliferates in the educational institutions in Brazil, therefore it is necessary to the teachers to become aware of your profession and the vision as such. Only from this perspective one can discuss a proper teacher training, aiming at the integration of all activities, valuing all with the same importance

Structural and functional characterization of an acidic platelet aggregation inhibitor and hypotensive phospholipase A(2) from Bothrops jararacussu snake venom

An acidic (pI similar to 4.5) phospholipase A(2) (BthA-I-PLA(2)) was isolated from Bothrops jararacussu snake venom by ion-exchange chromatography on a CM-Sepharose column followed by reverse phase chromatography on an RP-HPLC C-18 column. It is an similar to13.7 kDa single chain Asp49 PLA(2) with approximately 122 amino acid residues, 7 disulfide bridges, and the following N-terminal sequence: 'SLWQFGKMINYVMJGESGVLQYLSYGCYCGLGGQGQPTDATDRCCFVHDCC(51). Crystals of this acidic protein diffracted beyond 2.0 Angstrom resolution. These crystals are monoclinic and have unit cell dimensions of a = 33.9, b = 63.8, c = 49.1 Angstrom, and beta = 104.0degrees. Although not myotoxic, cytotoxic, or lethal, the protein was catalytically 3-4 tithes more active than BthTX-II, a basic D49 myotoxic PLA(2) from the same venom and other Bothrops venoms. Although it showed no toxic activity, it was able to induce time-independent edema, this activity being inhibited by EDTA. In addition, BthA-I-PLA(2) caused a hypotensive response in the rat and inhibited platelet aggregation, Catalytic, antiplatelet and other activities were abolished by chemical modification with 4-bromophenacyl bromide, which is known to covalently bind to His48 of the catalytic site. Antibodies raised against crude B. jararacussu venom recognized this acidic PLA(2), while anti-Asp49-BthTX-II recognized it weakly and anti-Lys49-BthTX-I showed the least cross-reaction. These data confirm that myotoxicity does not necessarily correlate with catalytic activity in native PLA(2) homologues and that either of these two activities may exist alone. BthA-I-PLA(2), in addition to representing a relevant molecular model of catalytic activity, is also a promising hypotensive agent and platelet aggregation inhibitor for further studies. (C) 2002 Elsevier B.V. All rights reserved.

Defining the student burnout construct: a structural analysis from three burnout inventories

College student burnout has been assessed mainly with the Maslach Burnout Inventory (MBI). However, the construct's definition and measurement with MBI has drawn several criticisms and new inventories have been suggested for the evaluation of the syndrome. A redefinition of the construct of student burnout is proposed by means of a structural equation model, reflecting burnout as a second order factor defined by factors from the MBI-Student Survey (MBI-SS); the Copenhagen Burnout Inventory-Student Survey (CBI-SS) and the Oldenburg Burnout Inventory-Student Survey (OLBI-SS). Standardized regression weights from Burnout to Exhaustion and Cynicism from the MBI-SS scale, Personal Burnout and Studies Related Burnout from the CBI, and Exhaustion and Disengagement from OLBI, show that these factors are strong manifestations of students' burnout. For college students, the burnout construct is best defined by two dimensions described as "physical and psychological exhaustion" and "cynicism and disengagement."

Synthesis and solid-state structural characterization of bis (thiocyanatemercury)tetracarbonyliron

The bis (thiocyanatemercury)tetracarbonyliron, [Fe(CO)4(HgSCN)2], was prepared from [Fe(CO) 5] and Hg(SCN)2, and studied by IR spectroscopy and X-ray diffraction. The compound crystallizes in the tetragonal space group I4,1/a. The unit cell, with dimensions of a = 13.778(3), c = 13.234(3) Å, V = 2512.3(9) Å3, contains four molecules. The iron atom is octahedrally coordinated by four carbonyl groups and two mercury atoms in cis positions. The coordination of the mercury atoms is distorted square-planar, since, besides mercury-iron and mercury-sulphur bonds, there are also mercury-mercury and mercury-nitrogen interactions. The FeHg distance is 2.506(5)Å and the HgFeHg angle is 78.0(1)°. © 1987.