Chemical Profile and Biological Potential of Non-Polar Fractions from Centroceras clavulatum (C. Agardh) Montagne (Ceramiales, Rhodophyta)

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Biological parameters and population structure of Psammobatis extenta in Ubatuba region, north coast of the State of São Paulo, Brazil

Specimens of the zipper sand skate Psammobatis extenta were collected in the region of Ubatuba off the northern coast of the State of São Paulo, Brazil, monthly for once year (January - December 2000), at 25- to 40-m isobaths. A total of 123 individuals were caught. The total length (TL) of females averaged 224.6 mm, and of males 217 mm. The overall sex ratio was 1:1. Analysis of the length-weight relationship indicated the existence of positive allometry in females, and isometry in males. The length at onset of sexual maturity was determined for both sexes; females reached sexual maturity at smaller sizes than males (TL50 = 230.7 and TL50 = 237.7 mm respectively). Females showed functional parity of both ovaries and uteri. Females that were pregnant or were carrying vitellogenic oocytes were observed during nine of 12 months of the survey, indicating a continuous reproductive cycle. Psammobatis extenta was most abundant from January to April, and again from June to October. Most individuals were collected at the 40-m isobath. Both adults and neonates were collected in the study area. However, adolescent skates were scarce, which either indicates differential occupation of the area, or suggests that the shallow waters of the continental shelf are used as breeding grounds.

Chemical structure, surface properties and biological activities of the biosurfactant produced by Pseudomonas aeruginosa LBI from soapstock

Pseudomonas aeruginosa LBI isolated from petroleum-contaminated soil produced rhamnolipids (RLLBI) when cultivated on soapstock as the sole carbon source. HPLC-MS analysis of the purified culture supernatant identified 6 RL homologues (%): R-2 C-10 C-10 28.9; R-2 C-10 C-12:1 23.0; R-1 C-10 C-10 23.4; R-2 C-10 C-12 11.3; R-2 C-10 C-12 7.9; R-2 C-10 C-12 C-12 5.5. To assess the potential antimicrobial activity of the new rhamnolipid product, RLLBI, its physicochemical properties were studied. RLLBI had a surface tension of 24 mN m(-1) and an interfacial tension 1.31 mN m(-1); the cmc was 120 mg l(-1). RLLBI produced stable emulsions with hydrocarbons and vegetable oils. This product showed good antimicrobial behaviour against bacteria: MIC for Bacillus subtilis, Staphylococcus aureus and Proteus vulgaris was 8 mg l(-1), for Streptococcus faecalis 4 mg l(-1), and for Pseudomonas aeruginosa 32 mg l(-1). RLLBI was active against phytopathogenic fungal species, MIC values of 32 mg l(-1) being found against Penicillium, Alternaria, Gliocadium virens and Chaetonium globosum. Due to its physicochemical properties and antimicrobial behaviour, RLLBI could be used in bioremediation treatment and in the food, cosmetic and pharmaceutical industries.

Effects of diuron on toxicological and hematological parameters and lymphohematopoietic organs in a rat chemical hepatocarcinogenesis model

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Effect of bacillus thuringiensis on the biological parameters and phytophagy of podisus nigrispinus (hemiptera: pentatomidae)

The effect of Bacillus thuringiensis Berliner 1911 var aizawai strain GC-91 (Bta) on the biological parameters and phytophagy of Podisus nigrispinus (Dallas 1851) (Hemiptera: Pentatomidae) were evaluated using the follow treatments: a) provision of deionized water and prey Plutella xylostella (Linnaeus 1758) (Lepidoptera: Plutellidae); b) provision of only a solution containing Bta; and c) provision of prey and the solution containing Bta. To evaluate the phytophagy of the predator, leaves of Brassica oleraceae var acephala Linnaeus cv Manteiga da Georgia were provided and replaced every two days, and subsequently stained by immersion in 1% acid fuchsin. Staining enabled the visualization of the feeding sheath, which allowed for the quantification of punctures inflicted by P nigrispinus. The phytophagy, reproductive capacity and biological cycle in P nigrispinus were negatively affected by the presence of Bta; however, its predatory capacity was not altered.

Purification and biological effects of a C-type lectin isolated from Bothrops moojeni

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Effects of Dimerization on the Structure and Biological Activity of Antimicrobial Peptide Ctx-Ha

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Itaipu reservoir limnology: eutrophication degree and the horizontal distribution of its limnological variables

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Synthesis, spectroscopic characterization and biological analysis of a new palladium(II) complex with methionine sulfoxide

A new palladium(II) complex with methionine sulfoxide was synthesized and characterized by a set of chemical and spectroscopic techniques. Elemental and mass spectrometry analyses of the solid complex fit to the composition [Pd(C5H10NO3S)(2)]center dot H2O. C-13 NMR, [H-1-N-15] NMR and infrared spectra indicate coordination of the amino acid to Pd(II) through the carboxylate and amino groups in a square planar geometry. The complex is soluble in water.Biological activity was evaluated by cytotoxic analysis using HeLa cells. Determination of cell death was assessed using a tetrazolium salt colorimetric assay, which reflects the cells viability. After incubation for 48 h, 20% of cell death was achieved at a concentration of 200 mu mol L-1 of the complex. (c) 2006 Elsevier B.V. All rights reserved.

Solids rheology for dehydrated food and biological materials

Mechanical properties of food products and biological materials are greatly affected by the drying process and are considered one of the most important quality attributes of dehydrated products. The aim of this work was to review theoretical principles and mathematical modeling, analyzing the measurement techniques and major experimental results that exist in the literature about rheological properties of dehydrated foods and biological materials. Different methods of measuring rheological parameters (fundamental and empiric or imitative) are discussed and major experimental results, as well as the rheological models used in their analysis, published in recent years are presented.

Purification and biological activity of the thrombin-like substance isolated from Bothrops insularis venom

The venom of Bothrops insidaris snake, known in Brazil as jararaca ilhoa, contains a variety of proteolytic enzymes such as a thrombin-like substance that is responsible for various pharmacological effects. B. insularis venom chromatography profile showed an elution of seven main fractions. The thrombin-like activity was detected in fractions I and 111, the latter being subjected to two other chromatographic procedures, so to say DEAE and Hi Trap Benzamidine. The purity degree of this fraction was confirmed by analytical reverse phase HPLC, which displayed only one main fraction confirmed by SDS-PAGE constituting fraction III. About 5 mu g of fraction III protein potentiated the secretion of insulin induced by 2.8mM of glucose in rats isolated pancreatic beta-cells treated; the increase being around 3-fold higher than its respective control. B. insidaris lectin (BiLec; 10 mu g/mL) was also studied as to its effect on the renal function of isolated perfused rat kidneys with the use of six Wistar rats. BiLec increased perfusion pressure (PP), renal vascular resistence (RVR), urinary flow (UF) and glomerular filtration rate (GFR). Sodium (%TNa+) and chloride tubular reabsorption (%TCl-) decreased at 120 min, without alteration in potassium transport. In conclusion, the thrombin-like substance isolated from B. insularis venom induced an increase in insulin secretion, in vitro, and transiently altered vascular, glomerular and tubular parameters in the isolated rat kidney. (c) 2006 Elsevier Ltd. All rights reserved.

Isolation, characterization and biological activity of acidic phospholipase A(2) isoforms from Bothrops jararacussu snake venom

Acidic phospholipase A(2) (PLA(2)) isoforms in snake venoms, particularly those from Bothrops jararacussu, have not been characterized. This article reports the isolation and partial biochemical, functional and structural characterization of four acidic PLA(2)s (designated SIIISPIIA, SIIISPIIB, SIIISPIIIA and SIIISPIIIB) from this venom. The single chain purified proteins contained 122 amino acid residues and seven disulfide bonds with approximate molecular masses of 15 kDa and isoelectric points of 5.3. The respective N-terminal sequences were: SIIISPIIA-SLWQFGKMIDYVMGEEGAKS; SIIISPIIB-SLWQFGKMIFYTGKNEPVLS; SIIISPIIIA-SLWQFGKMILYVMGGEGVKQ and SIIISPIIIB-SLWQFGKMIFYEMTGEGVL. Crystals of the acidic protein SIIISPIIIB diffracted beyond 1.8 Angstrom resolution. These crystals are monoclinic with unit cell dimensions of a = 40.1 Angstrom, b = 54.2 Angstrom and c = 90.7 Angstrom. The crystal structure has been refined to a crystallographic residual of 16.1% (R-free = 22.9%). Specific catalytic activity (U/mg) of the isolated acidic PLA(2)s were SIIISPIIA = 290.3 U/mg; SIIISPIIB = 279.0 U/mg; SIIISPIIIA = 270.7 U/mg and SIIISPIIIB = 96.5 U/mg. Although their myotoxic activity was low, SIIISPIIA, SIIISPIIIB and SIIISPIIIA showed significant anticoagulant activity. However, there was no indirect hemolytic activity. SIIISPIIIB revealed no anticoagulant, but presented indirect hemolytic activity. With the exception of SIIISPIIIB, which inhibited platelet aggregation, all the others were capable of inducing time-independent edema. Chemical modification with 4-bromophenacyl bromide did not inhibit the induction of edema, but did suppress other activities. (C) 2003 Editions scientifiques et medicales Elsevier SAS. All rights reserved.

Spatial and temporal variability of soil CO2 emission in a sugarcane area under green and slash-and-burn managements

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)

Effect of atypical rainfall on lotic zooplankton: comparing downstream of a reservoir and tributaries with free stretches

To contribute to the knowledge of lotic zooplankton from dammed and free stretches, we tested the hypothesis that the ecological attributes are different between these environments, which are subjected to several effects caused by different hydrological conditions. The study was carried out in the low Iguacu river, a large hydrographic basin in the south of Brasil. Two samplings were performed, one in the dry period (April/04) and the other in the atypical rainy period (July/04), in five stations downstream a large reservoir, and other 12 stations in four tributaries representing the upper, intermediate and low regions of each river. The observations suggest a clear spatial distribution of zooplankton in lotic stretches subjected or not to damming, mainly due to the effects of physical, chemical and biological variables. Furthermore, the atypical rainfall promoted alterations in community structure when compared to the dry period.

Synthesis, characterization, and biological activity of a new palladium(II) complex with deoxyalliin

Synthesis, characterization, and biological activity of a new water-soluble Pd(II)-deoxyalliin (S-allyl-L-cysteine) complex are described in this article. Elemental and thermal analysis for the complex are consistent with the formula [Pd(C6H10NO2S)2]. 13C NMR, 1H NMR, and IR spectroscopy show coordination of the ligand to Pd(II) through S and N atoms in a square planar geometry. Final residue of the thermal treatment was identified as a mixture of PdO and metallic Pd. Antiproliferative assays using aqueous solutions of the complex against HeLa and TM5 tumor cells showed a pronounced activity of the complex even at low concentrations. After incubation for 24 h, the complex induced cytotoxic effect over HeLa cells when used at concentrations higher than 0.40 mmol/L. At lower concentrations, the complex was nontoxic, indicating its action is probably due to cell cycle arrest, rather than cell death. In agreement with these results, the flow cytometric analysis indicated that after incubation for 24 h at low concentrations of the complex cells are arrested in G0/G1. © 2005 NRC Canada.