Avaliação da atividade dos óleos essenciais de cymbopogon citratus (D.C.) Stapf, Tagetes minuta L. e Curcuma zedoaria roscoe frente aos microrganismos Candida spp., Staphylococcus spp. e Streptococcus mutans

Pós-graduação em Biopatologia Bucal - ICT

Perfil clonal e fatores de patogenicidade de Staphylococcus spp. no prognóstico das peritonites em diálise peritoneal

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Importância da virulência nas linhagens de Staphylococcus spp. em portadores e no risco de peritonites em diálise peritoneal ambulatorial

Pós-graduação em Fisiopatologia em Clínica Médica - FMB

Estudo epidemiológico de Staphylococcus spp em ambientes, água e portadores sadios e determinação da sensibilidade a antimicrobianos

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Produção de anticorpos monoclonal murino dirigido contra a PBP2a do S. aureus resistente a meticilina

Pós-graduação em Pesquisa e Desenvolvimento (Biotecnologia Médica) - FMB

Diversity of Staphylococcus species and prevalence of enterotoxin genes isolated from milk of healthy cows and cows with subclinical mastitis

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Staphylococcus sp na produção primária de leite: aspectos de saúde pública

Staphylococcus is one of the more important causes of the called Foodborne Disease(FD), being that from the 40 species described from genus, the more important is Staphylococcus aureus. During years believed that the S. aureus was the only specie from genus able to produce enterotoxins, responsable for the clinical frame in humans, but latest studies report the isolation of other species both positive coagulase (PC) as negative with enterotoxigenic potential. The symptoms of this intoxication appear after a short period of incubation (2-6 hours) and usually characterized by nausea, vomits, abdominal ache, diarrhea, and rarely is fatal. For the toxin to be formed in food is necessary that bacteria population to be at least 105 UFC/g, being that such toxins characterized by presenting great resistance front of gastrointestinal proteases and of homemade termical treatment. Among the main foods that might carry the microorganism, the milk and its derivatives have highlights. The contamination of the product might happen as from the milk from cows with clinical and/or subclinical mastitis, as the Staphylococcus genus is one of the main agents etiologic from this disease, equipments utensils badly sanitized equipments and utensils and from the manipulators. The control of these factors configures as fundamental condition for the achievement of a safe, quality product, which doesn’t offer risk to the consumers

Estudo dos fatores de virulência e resistência à oxacilina em Staphylococcus spp. isolados de aspirado traqueal de pacientes em ventilação mecânica internados em UTI

Patients that are mechanically ventilated in ICUs are constantly exposed to different pathogens, which present multiantibiotic resistance. Among these microorganisms, is MRSA (Meticillin-Resistant Staphylococcus aureus) considered to be a therapeutic challenge due to its resistance to β-lactam antibiotics. Therefore, this study proposed to identify species of Staphylococcus spp. isolated from mechanically ventilated patients in ICU, the gene mecA detection and the genes of the enterotoxins A (sea), B (seb), C (sec-1) and D (sed) in samples of S. aureus, as well as the phenotypic resistance determination to oxacillin using the disc-diffusion method with discs of oxacillin and cefoxitin. The samples collection occurred during in a period of 19 months, obtaining samples from 232 patients. A percentage of 39% (70) of Gram-positive cocci were found; which 82,8% (58) were identified as Staphylococcus spp,. among these, 75,8% (44) corresponded to S. aureus species and 47,7% were identified as MRSA. It was found resistance to both drugs in 31,8% of the S. aureus samples, 16 (36,3%) had the gene sea and 11 (25%) had the sec-1 gene. Among the coagulase-negative staphylococci obtained, the species most found was S. epidermidis, corresponding to 43% (6). The results revealed that one of the most important etiologic agents of VAP amid the Gram-positive cocci is the species S. aureus, with special attention to MRSA. The presence of enterotoxins genes in S. aureus did not showed determinant role in VAP, but the presence of these superantigens can contribute worsening the patient’s prognosis, since they are associated with intense inflammatory response

Avaliação in vitro da eficácia de extratos de plantas medicinais do Cerrado frente Staphylococcus aureos isolado de difetentes fontes de propriedades leiteiras

The objective of this study is to evaluate the potencial microbial activity in-vitro from the extract of some endemic plants from Cerrado such as Baccharis dracunculifolia, Cochlospermum regium, Croton antisyphiliticus, Eugenia dysenterica and Lippia sidoides, against the agent Staphylococcus aureus isolated from bovine mastitic milk, osteo from cow’s teat, milker equipament, nasal cavitites and milker’s gullet. The extracts were prepared from aerial parts as well as the reticular systems of plants using the solvents methanol, hexane and chloroform at a concentration of 10%. To evaluate the antimicrobial activity, the technique of microdilution in broth was used for determining the Minimal Inibitory Concentration (MIC) followed by the determination of Minimal Bactericidal Concentration (MBC). The extracts from Baccharis dracunculifolia and Croton antisyphiliticus, followed by extracts from Lippia sidoides, reported respectively, presented better inhibitory activity against the multiplication of the bacteria Staphylococcus aureus. Furthermore, the results demonstrate that the isolated strains from the milk and nasal cavities of the milker showed strong resistance against gentamicin, active agent commonly applied to combat mastitis bovine. However, there was sensitivity against extracts from the reported plants, reinforcing the importance of the medicinal plants as a therapeutic resource and its aplicability.

Structure-function relationship of new crotamine isoform from the Crotalus durissus cascavella

In this work we isolated a novel crotamine like protein from the Crotalus durissus cascavella venom by combination of molecular exclusion and analytical reverse phase HPLC. Its primary structure was:YKRCHKKGGHCFPKEKICLPPSSDLGKMDCRWKRK-CCKKGS GK. This protein showed a molecular mass of 4892.89 da that was determined by Matrix Assisted Laser Desorption Ionization Time-of-flight (MALDI-TOF) mass spectrometry. The approximately pI value of this protein was determined in 9.9 by two-dimensional electrophoresis. This crotamine-like protein isolated here and that named as Cro 2 produced skeletal muscle spasm and spastic paralysis in mice similarly to other crotamines like proteins. Cro 2 did not modify the insulin secretion at low glucose concentration (2.8 and 5.6 mM), but at high glucose concentration (16.7 mM) we observed an insulin secretion increasing of 2.7-3.0-fold than to control. The Na+ channel antagonist tetrodoxin (6 mM) decreased glucose and Cro 2-induced insulin secretion. These results suggested that Na+ channel are involved in the insulin secretion. In this article, we also purified some peptide fragment from the treatment of reduced and carboxymethylated Cro 2 (RC-Cro 2) with cyanogen bromide and protease V8 from Staphylococcus aureus. The isolated pancreatic beta-cells were then treated with peptides only at high glucose concentration (16.7 mM), in this condition only two peptides induced insulin secretion. The amino acid sequence homology analysis of the whole crotamine as well as the biologically-active peptide allowed determining the consensus region of the biologically-active crotamine responsible for insulin secretion was KGGHCFPKE and DCRWKWKCCKKGSG.

Prevalence and antimicrobial resistance patterns of methicillin-resistant staphylococci (MRS) isolated in a Veterinary Teaching Hospital in Brazil

Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES)

Prevalence of Methicillin-Resistant Staphylococci on a Farm: Staff can Harbour MRS When Animals do Not

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)

Avaliação microbiológica de um processo de sanificação de galões de água com a utilização do ozônio

O Brasil é o sétimo maior consumidor mundial de águas engarrafadas. Os recipientes mais utilizados, galões plásticos de 20 litros, devem ser submetidos à inspeção individual e posteriormente a sanificação. Recentemente, enfermidades associadas a microrganismos emergentes têm despertado o interesse por novos sanitizantes. Entre estes, o gás ozônio é um dos mais atraentes em virtude da sua segurança e eficácia superiores aos desinfetantes convencionais, não gerando resíduos tóxicos. Neste trabalho, o ozônio foi avaliado como método alternativo na sanificação de galões de água de 20 litros, na cidade de Alfenas, MG. Trinta galões foram avaliados sem tratamento e trinta após a sanificação com água ozonizada (4mg/L/2minutos) quanto à contagem total de microrganismos aeróbios mesófilos heterotróficos, número mais provável (NMP) de coliformes totais e Escherichia coli, Staphyloccocus aureus e Pseudomonas spp. em 100mL de solução enxaguatória. A contagem média de unidades formadoras de colônias (UFC) de microrganismos heterotróficos no estágio de pré-lavagem foi de 5,7/cm² enquanto que o tratamento com a água ozonizada reduziu este valor para 0,003/cm², além de promover a negativação das análises para coliformes Pseudomonas ssp. e somente 13,3% das amostras apresentaram-se positivas para Staphylococcus aureus após a sanificação. Concluiu-se que o tratamento com utilização de ozônio foi eficiente, nas condições testadas.

Comportamento da condutividade elétrica e do conteúdo de cloretos do leite como métodos auxiliares de diagnóstico na mastite subclínica bovina

Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP)