357 resultados para RC slabs
Resumo:
This work presents a boundary element formulation for the analysis of building floor slabs, without beams, in which columns are coupled with the plate. An alternative formulation of boundary element method is presented, which considers three nodal displacements values (w, partial derivativew/partial derivativen and partial derivativew/partial derivatives) for the nodes at the boundary of the plate. In this formulation three boundary equations are written for all nodes at the boundary and in the domain of the plate. As the nodes of the column-plate connections are also represented by three nodal values, all these structural elements can be easily coupled. It is supposed that the cross-sections of the columns remain flat after the deflection and consequently the assumption of linear variation of the stress in the plate-column contact surface is also valid. (C) 2003 Elsevier B.V. Ltd. All rights reserved.
Resumo:
Structural and electronic properties of the bulk and relaxed surfaces (TiO2 and PbO terminated) of cubic PbTiO3 are investigated by means of periodic quantum-mechanical calculations based on density functional theory. It is observed that the difference in surface energies is small and relaxations effects are most prominent for Ti and Ph surface atoms. The electronic structure shows a splitting of the lowest conduction bands for the TiO2 terminated surface and of the highest valence bands for the PbO terminated slab. The calculated indirect band gap is: 3.18, 2.99 and 3.03 eV for bulk, TiO2 and PbO terminations, respectively. The electron density maps show that the Ti-O bond has a partial covalent character, whereas the Pb-O bonds present a very low covalency. (C) 2004 Elsevier B.V. All rights reserved.
Resumo:
In this work, a numerical model to perform non-linear analysis of building floor structures is proposed. The presented model is derived from the Kirchhoff-s plate bending formulation of the boundary element method (BENI) for zoned domains, in which the plate stiffness is modified by the presence of membrane effects. In this model, no approximation of the generalized forces along the interface is required and the compatibility and equilibrium conditions along interfaces are imposed at the integral equation level. In order to reduce the number of degrees of freedom, the Navier Bernoulli hypothesis is assumed to simplify the strain field for the thin sub-regions (rectangular beams). The non-linear formulation is obtained from the linear formulation by incorporating initial internal force fields, which are approximated by using the well-known cell sub-division. Then, the non-linear solution of algebraic equations is obtained by using the concept of the consistent tangent operator. The Von Mises criterion is adopted to govern the elasto-plastic material behaviour checked at points along the plate thickness and along the rectangular beam element axes. The numerical representations are accurately obtained by either computing analytically the element integrals or performing the numerical integration accurately using an appropriate sub-elementation scheme. (C) 2007 Elsevier Ltd. All rights reserved.
Resumo:
An alternative formulation for guided electromagnetic fields in grounded chiral slabs is presented. This formulation is formally equivalent to the double Fourier transform method used by the authors to calculate the spectral fields in open chirostrip structures. In this paper, we have addressed the behavior of the electromagnetic fields in the vicinity of the ground plane and at the interface between the chiral substrate and the free space region. It was found that the boundary conditions for the magnetic field, valid for achiral media, are not completely satisfied when we deal with chiral material. Effects of chirality on electromagnetic field distributions and on surface wave dispersion curves were also analyzed.
Resumo:
This paper presents a new model for the representation of the electrodes filaments of fluorescent lamps, during their preheating, and an analysis capable to guide the design of the preheating process in electronic ballasts. The main improvement obtained with the lamp model is the accurate theoretical reproduction of the behavior of the Rh/Rc ratio during the preheating process. In addition, using the proposed methodology based on the lamp model, it is possible to set a proper preheating process to the electrodes filaments, without the necessity of exhaustive empirical adjustments in the prototype, reducing time and costs involved in the design of ballasts with preheating capabilities. © 2006 IEEE.
Resumo:
This paper presents a numerical approach to model the complex failure mechanisms that define the ultimate rotational capacity of reinforced concrete beams. The behavior in tension and compression is described by a constitutive damage model derived from a combination of two specific damage models [1]. The nonlinear behavior of the compressed region is treated by the compressive damage model based on the Drucker-Prager criterion written in terms of the effective stresses. The tensile damage model employs a failure criterion based on the strain energy associated with the positive part the effective stress tensor. This model is used to describe the behavior of very thin bands of strain localization, which are embedded in finite elements to represent multiple cracks that occur in the tensioned region [2]. The softening law establishes dissipation energy compatible with the fracture energy of the concrete. The reinforcing steel bars are modeled by truss elements with elastic-perfect plastic behavior. It is shown that the resulting approach is able to predict the different stages of the collapse mechanism of beams with distinct sizes and reinforcement ratios. The tensile damage model and the finite element embedded crack approach are able to describe the stiffness reduction due to concrete cracking in the tensile zone. The truss elements are able to reproduce the effects of steel yielding and, finally, the compressive damage model is able to describe the non-linear behavior of the compressive zone until the complete collapse of the beam due to crushing of concrete. The proposed approach is able to predict well the plastic rotation capacity of tested beams [3], including size-scale effects.
Resumo:
Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq)
Resumo:
Não disponível
Resumo:
In this work we isolated a novel crotamine like protein from the Crotalus durissus cascavella venom by combination of molecular exclusion and analytical reverse phase HPLC. Its primary structure was:YKRCHKKGGHCFPKEKICLPPSSDLGKMDCRWKRK-CCKKGS GK. This protein showed a molecular mass of 4892.89 da that was determined by Matrix Assisted Laser Desorption Ionization Time-of-flight (MALDI-TOF) mass spectrometry. The approximately pI value of this protein was determined in 9.9 by two-dimensional electrophoresis. This crotamine-like protein isolated here and that named as Cro 2 produced skeletal muscle spasm and spastic paralysis in mice similarly to other crotamines like proteins. Cro 2 did not modify the insulin secretion at low glucose concentration (2.8 and 5.6 mM), but at high glucose concentration (16.7 mM) we observed an insulin secretion increasing of 2.7-3.0-fold than to control. The Na+ channel antagonist tetrodoxin (6 mM) decreased glucose and Cro 2-induced insulin secretion. These results suggested that Na+ channel are involved in the insulin secretion. In this article, we also purified some peptide fragment from the treatment of reduced and carboxymethylated Cro 2 (RC-Cro 2) with cyanogen bromide and protease V8 from Staphylococcus aureus. The isolated pancreatic beta-cells were then treated with peptides only at high glucose concentration (16.7 mM), in this condition only two peptides induced insulin secretion. The amino acid sequence homology analysis of the whole crotamine as well as the biologically-active peptide allowed determining the consensus region of the biologically-active crotamine responsible for insulin secretion was KGGHCFPKE and DCRWKWKCCKKGSG.
Resumo:
The effects of the Linear Alkylbenzene Sulphonate (LAS) were evaluated on the mussel Perna perna, using physiological and genotoxic biomarkers. The Micronuclei (MN) assay was used to estimate effects at nuclear level, whereas the physiological effects were evaluated by measuring the oxygen consumption and ammonia excretion rates. Significant effects were observed for the MN assay and the ammonia excretion rate, even in low concentrations. The oxygen consumption was not affected in the tested concentrations. For MN and ammonia excretion, the animals exposed to intermediate concentrations were not affected, but responded to the higher concentrations, indicating the existence of compensatory mechanisms at physiological level. However, parallel to this study other authors indicate the presence of progressive effects at the cellular level, suggesting that the organisms are not capable to recover of such increasing effects. Additionally, the results show that the levels of LAS observed for Brazilian coastal waters may chronically affect the biota.
Resumo:
Several diseases involve the nervous system of cattle, among which infections with Rabies Virus and Bovine Herpes Virus 5 (BoHV-5) are noteworthy. In order to detect seropositive animals to BoHV-5, 156 Brahman-Zebu bovines blood samples from Colombia's eastern plains were analyzed through seroneutralization assay; the area has a history of animals dying with nervous symptoms and which rule out the disease of rabies. All animals were over one year old and randomly selected from two different herds reporting no vaccination for infectious bovine rhinotracheitis in a period exceeding one year. Results indicated seropositivity for BoHV-5 in 91 cases (58.4%), of which 88 were also seropositive for bovine herpes virus 1 (BoHV-1), while 41 were seronegative for both agents. 22/64 seronegative cases for BoHV-5 were seropositive for BoHV-1 and 2/43 seronegative cases for BoHV-1 were seropositive for BoHV-5, and consequently, these animals could be only infected by encephalitis herpes virus. With these initial findings, emphasis its placed on the need establish the true impact of the disease in Colombia and proposes the epidemiological surveillance of cattle in the region studied in order to establish mechanisms for control of viral infection.
Resumo:
A importância econômica de possíveis características biológicas a serem incluídas em objetivos de seleção para diferentes sistemas de produção de bovinos da raça Nelore, mediante o cálculo dos seus valores econômicos foi avaliada nesta pesquisa. Com base em informações de desempenho e parâmetros biológicos e econômicos, foram simulados diferentes sistemas de produção (ciclos de cria e completo) para dois rebanhos. O rebanho 1, com ciclo de cria (Ccr), ciclo completo (Cco) e ciclo completo com venda de reprodutores (CcoR), é um rebanho elite no qual é desenvolvido um programa seleção. Parte deste rebanho é também destinada à produção de animais comerciais. O rebanho 2 é um rebanho exclusivamente comercial, com Ccr e Cco. Os valores econômicos foram calculados usando-se um modelo bio-econômico, para as seguintes características: peso (PD) e taxa de desmama (TD), peso da vaca adulta (PVA), ganho médio diário no confinamento (GMD), pesos ao abate (PA) e de carcaça (PC), peso final dos tourinhos (PFT), rendimento de carcaça (RC) e consumo alimentar no confinamento (CAc) e em pastagem (CAp). Para os sistemas de ciclo completo e de ciclo completo com venda de reprodutores e CcoR (Cco e CcoR), os valores econômicos variaram de R$ 0,34 a R$ 0,40 para PD, R$ 3,51 a R$ 10,15 para TD, -R$ 0,16 a R$ 0,09 para PAV, R$ 0,32 a R$ 0,76 para GMDc, R$ 1,09 a R$ 1,17 para PA; R$ 2,03 a R$ 2,19 para PC, R$ 23,89 a R$ 28,61 para RC, e R$ 11,85 para PFT, - R$0,45 para CAc e - R$ 0,03 para CAp. A taxa de desmama e o rendimento de carcaça foram as características de maior impacto no lucro anual dos dois rebanhos. As análises de sensibilidade demonstraram que, de modo geral, possíveis mudanças nos preços de insumos e produtos influenciariam de forma mais significativa os valores econômicos nos sistemas de produção nos quais esses preços eram mais elevados nas situações básicas.
Resumo:
Este trabalho objetivou determinar o albedo (r) no espectro solar e estimar o saldo de radiação, em ambientes cultivados com feijão-vagem (Phaseolus vulgaris L.), em condições de campo e em casa de vegetação com cobertura de polietileno, em Botucatu, SP, (22º 54' S; 48º 27' W; 850 m). A irradiância solar global (Rg) e a radiação solar refletida (Rr) foram utilizadas na determinação do albedo através da razão entre Rr e Rg. Curvas diurnas de r foram traçadas para dias com céu parcialmente nublado e claro, em fases fenológicas da cultura. Os valores do albedo diurno, obtidos através dos totais de radiações, foram utilizados para analisar a variação desse índice durante o ciclo da cultura, nos dois ambientes. O albedo variou com a elevação solar, o ambiente e as fases fenológicas da cultura. A variação de nebulosidade praticamente não influiu sobre o albedo, para totais diurnos. As estimativas do saldo de radiação nas fases vegetativa, reprodutiva e no ciclo da cultura, foram realizadas por meio de regressões lineares simples, tendo como variáveis independentes a irradiância solar global (Rg) e o saldo de radiação de ondas curtas (Rc). Todas as estimativas de radiações apresentaram um melhor ajustamento para fases fenológicas que para o ciclo como um todo. O saldo de radiação (Rn), em condições de campo, ficou bem estimado pela irradiância solar global e o saldo de ondas curtas. O saldo de radiação interno (RnI) à casa de vegetação mostrou-se satisfatoriamente estimado pela irradiância global externa (RgE).
Resumo:
This research was supported theory as the theory of Henri Wallon which proposes a reflection on the overall development of the child offering subsidies for a acting that values the child in its multiple dimensions. The objective is understood to seek subsidies in theory that can guide the construction of an education in the Children's activites, focused on the development aspects of cognitive, affective and motor of the child. It adopts as methodology the bibliographical revision, the intervention, observation and data collect, using as pedagogic resource playing activities in an institution of Infantile Education. The research noted the possibility of action with the concepts proposed by the Wallonian theory, furthermore, the Children's Fitness, using the recreational activities such as teaching resources boost child development. Therefore, concluded that physical education should include Child in the process of teaching-learning the full development of the child.
Resumo:
To analyze influences of the physical activity and sedentary behaviors on indicators of both central and total body fat in male adolescents. Cross-sectional study with 60 male students of age range from 11 to 14 years old. It were evaluated the body mass, height, triceps skinfold, waist circumference, body fat percentage (bioelectrical impedance) and the physical activity level through questionnaire. The physical inactivity prevalence was of 35%, and the excessive total and central body fat were observed in 38.3% and 48.3% of the sample, respectively. There was association of the sedentary behaviors with the excessive total and central body fat (OR = 5.2 e OR = 6.4, respectively), however there was not for physical activity. The adoption of sedentary behaviors is associated at the development of the total and central obesity among male adolescents.