470 resultados para European universities


Relevância:

20.00% 20.00%

Publicador:

Resumo:

This study investigates how habitat variation affects sett density, the number of animals per social group and group territory size in the badger (Meles meles). Identical methods were applied in three habitat types: lowland parkland with mixed woodland, pastoral farmland and upland rough pasture with moorland, representing areas of presumed good, medium and poor badger habitat, respectively. Contiguous main setts were identified and bait-marking was used to estimate territory size. Group size was estimated by direct enumeration. Variation in sett density, group size and territory size supported the hypothesis that badger group and territory size are influenced by habitat type. This was further supported by analyses of data from other studies in the British Isles. The implications for badger spatial ecology, badger survey techniques and the badger's role in the epidemiology of TB are discussed.

Relevância:

20.00% 20.00%

Publicador:

Relevância:

20.00% 20.00%

Publicador:

Resumo:

1. Tachykinin immunoreactivity has been localized, quantified and chromatographically-characterized in the brain, stomach, intestine and skin of Rana temporaria.

Relevância:

20.00% 20.00%

Publicador:

Relevância:

20.00% 20.00%

Publicador:

Resumo:

Pancreatic polypeptide (PP) has been isolated from extracts of the pancreas of the European hedgehog (Erinaceous europaeus) which is a representative of the order Insectivora, deemed to be the most primitive group of placental mammals. Pancreatic tissues were extracted in acidified ethanol and the peptide was purified chromatographically using a PP C-terminal hexapeptide amide specific radioimmunoassay to monitor purification. Two major PP-immunoreactive peptides were baseline-resolved following the final analytical reverse phase HPLC fractionation. Each was separately subjected to plasma desorption mass spectroscopy (PDMS) and gas-phase sequencing. The molecular masses of each peptide were similar: (I) 4237.6 +/- 4 Da and (II) 4238.2 +/- 4 Da. The full primary structures of each peptide were deduced and these were identical: VPLEPVYPGDNATPEQMAHYAAELRRYINMLTRPRY. The peptides were deemed to be amidated due to their full molar cross-reactivity with the amide-requiring PP antiserum employed in radioimmunoassay. The molecular mass (4233.8 Da) calculated from the sequence was in close agreemeent with PDMS estimates and the reason for the different retention times of each peptide is unknown at present. Hedgehog PP exhibits only 2 unique amino acid substitutions, at positions 1 (Val) and 19 (His), when compared with other mammalian analogues.