2 resultados para Bronchial spasm
em Universidade Estadual Paulista "Júlio de Mesquita Filho" (UNESP)
Resumo:
In this work we isolated a novel crotamine like protein from the Crotalus durissus cascavella venom by combination of molecular exclusion and analytical reverse phase HPLC. Its primary structure was:YKRCHKKGGHCFPKEKICLPPSSDLGKMDCRWKRK-CCKKGS GK. This protein showed a molecular mass of 4892.89 da that was determined by Matrix Assisted Laser Desorption Ionization Time-of-flight (MALDI-TOF) mass spectrometry. The approximately pI value of this protein was determined in 9.9 by two-dimensional electrophoresis. This crotamine-like protein isolated here and that named as Cro 2 produced skeletal muscle spasm and spastic paralysis in mice similarly to other crotamines like proteins. Cro 2 did not modify the insulin secretion at low glucose concentration (2.8 and 5.6 mM), but at high glucose concentration (16.7 mM) we observed an insulin secretion increasing of 2.7-3.0-fold than to control. The Na+ channel antagonist tetrodoxin (6 mM) decreased glucose and Cro 2-induced insulin secretion. These results suggested that Na+ channel are involved in the insulin secretion. In this article, we also purified some peptide fragment from the treatment of reduced and carboxymethylated Cro 2 (RC-Cro 2) with cyanogen bromide and protease V8 from Staphylococcus aureus. The isolated pancreatic beta-cells were then treated with peptides only at high glucose concentration (16.7 mM), in this condition only two peptides induced insulin secretion. The amino acid sequence homology analysis of the whole crotamine as well as the biologically-active peptide allowed determining the consensus region of the biologically-active crotamine responsible for insulin secretion was KGGHCFPKE and DCRWKWKCCKKGSG.
Resumo:
The prevalence and infestation intensities of Octolasmis lowei in the bronchial chambers of Libinia spinosa were evaluated according to the host's sex, size, and moult condition. Epibionts were classified as cyprid larvae, non-ovigerous or ovigerous according to their developmental stage. A median intensity of infestation of 21 epibionts/host was found (range = 1-644; Q(3) = 81). Epibiont prevalence values (88%) were higher on ovigerous female hosts than on males (55%) or on non-ovigerous females (31%). Intensity of infestation was positively correlated with host size in both sexes for non-ovigerous and ovigerous epibionts. No preference between host sex by cyprid larvae was observed, nor any correlation between cyprid abundance and host size. Cyprid larvae abundance was positively correlated with settled epibionts on both host sexes. The duration of the intermoult phase was the main factor linked to the establishment of sessile epibionts. These observations are important in relation to crabs that have a terminal moult, because these animals cannot eliminate their epibionts in future moults, thus increasing the importance of density-dependent mechanisms on epibiont establishment; in that way, prevalence of infestation alone can underestimate the real impact of infestation on the host's life cycle.